Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SML9

Protein Details
Accession R7SML9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
110-131EEPVPPPKRKRTLKERLAPTLRBasic
NLS Segment(s)
PositionSequence
117-120KRKR
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
KEGG dsq:DICSQDRAFT_173971  -  
Amino Acid Sequences NNKYPSLTHAISLAEELDIPATPERIRTLENLVRQLPTSTGSSTTSSETLRETETVSSDVPSASISLSSPDTSREPSPIRSGTAVLRLGRTKAPSPLTTDGEDPLFSDEEEPVPPPKRKRTLKERLAPTLRERLDDPMDEADDAVSLGLTDAEEEIDNFFERTWYCRKFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.08
5 0.07
6 0.08
7 0.08
8 0.1
9 0.1
10 0.11
11 0.14
12 0.15
13 0.16
14 0.17
15 0.24
16 0.28
17 0.33
18 0.36
19 0.35
20 0.34
21 0.33
22 0.32
23 0.24
24 0.21
25 0.19
26 0.15
27 0.15
28 0.16
29 0.17
30 0.18
31 0.19
32 0.18
33 0.17
34 0.16
35 0.16
36 0.15
37 0.14
38 0.13
39 0.13
40 0.12
41 0.13
42 0.13
43 0.12
44 0.12
45 0.11
46 0.1
47 0.09
48 0.08
49 0.07
50 0.05
51 0.05
52 0.05
53 0.06
54 0.07
55 0.08
56 0.08
57 0.1
58 0.11
59 0.13
60 0.14
61 0.16
62 0.17
63 0.19
64 0.23
65 0.22
66 0.22
67 0.2
68 0.21
69 0.17
70 0.19
71 0.2
72 0.16
73 0.16
74 0.16
75 0.17
76 0.17
77 0.18
78 0.16
79 0.18
80 0.21
81 0.2
82 0.25
83 0.27
84 0.28
85 0.27
86 0.26
87 0.23
88 0.2
89 0.19
90 0.14
91 0.12
92 0.09
93 0.08
94 0.08
95 0.07
96 0.08
97 0.09
98 0.1
99 0.13
100 0.18
101 0.23
102 0.28
103 0.37
104 0.46
105 0.54
106 0.62
107 0.68
108 0.74
109 0.79
110 0.83
111 0.81
112 0.81
113 0.77
114 0.72
115 0.65
116 0.64
117 0.54
118 0.47
119 0.41
120 0.37
121 0.35
122 0.32
123 0.3
124 0.23
125 0.23
126 0.21
127 0.2
128 0.14
129 0.11
130 0.1
131 0.07
132 0.04
133 0.03
134 0.03
135 0.04
136 0.03
137 0.04
138 0.04
139 0.05
140 0.05
141 0.06
142 0.07
143 0.08
144 0.09
145 0.09
146 0.09
147 0.1
148 0.11
149 0.15
150 0.24
151 0.28