Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7SME5

Protein Details
Accession R7SME5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
38-64HPKRDPCSQRPSAKKRKKWSVMSGIRLHydrophilic
NLS Segment(s)
PositionSequence
48-55PSAKKRKK
Subcellular Location(s) mito 19.5, cyto_mito 10.833, nucl 5.5, cyto_nucl 3.833
Family & Domain DBs
KEGG dsq:DICSQDRAFT_140461  -  
Amino Acid Sequences MKGGRCTSSSAAPPPFIPSSAVFPSSGPHLPLPQSPGHPKRDPCSQRPSAKKRKKWSVMSGIRLTRPDWRDMAKGWRKLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.27
4 0.25
5 0.2
6 0.23
7 0.23
8 0.24
9 0.19
10 0.18
11 0.18
12 0.19
13 0.19
14 0.15
15 0.14
16 0.14
17 0.15
18 0.16
19 0.19
20 0.17
21 0.2
22 0.27
23 0.31
24 0.36
25 0.39
26 0.4
27 0.4
28 0.48
29 0.5
30 0.47
31 0.51
32 0.52
33 0.56
34 0.64
35 0.71
36 0.72
37 0.77
38 0.81
39 0.82
40 0.85
41 0.86
42 0.84
43 0.83
44 0.83
45 0.81
46 0.79
47 0.76
48 0.69
49 0.63
50 0.56
51 0.48
52 0.46
53 0.4
54 0.37
55 0.33
56 0.34
57 0.34
58 0.36
59 0.46
60 0.47