Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O74368

Protein Details
Accession O74368    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-78DETPSTPLSNNKKRYKKPLTILEPHHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, E.R. 4, cyto 3.5, cyto_nucl 3.5, plas 3, nucl 2.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027537  Mmm1  
IPR019411  MMM1_dom  
IPR031468  SMP_LBD  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0032865  C:ERMES complex  
GO:0008289  F:lipid binding  
GO:0120010  P:intermembrane phospholipid transfer  
GO:0000002  P:mitochondrial genome maintenance  
GO:1990456  P:mitochondrion-endoplasmic reticulum membrane tethering  
GO:0015914  P:phospholipid transport  
GO:0045040  P:protein insertion into mitochondrial outer membrane  
KEGG spo:SPBC27B12.01c  -  
Pfam View protein in Pfam  
PF10296  MMM1  
PROSITE View protein in PROSITE  
PS51847  SMP  
CDD cd21671  SMP_Mmm1  
Amino Acid Sequences MIHLPQGSFTQGLIVGQLLTLAIIYVFLRFFLFCSPIPKSVANSPKQTGNETPDETPSTPLSNNKKRYKKPLTILEPHILNLLYDVNEHEPESLDWFNVLIAQALIQFRYDACSNDVALRKLETVLNKGAQDKSMVDHIYVRDLSLGDGFPVFSHCRVLPHQHNSSQLRAEMLVSLTDNINCTVDTKLLLNFPKPAFATLPLSITVRICKFVGKIMIYFSPSNGAGQPAYMNLSFDPNFVISLQVSSLVGARSKLQDIPKITQLIESRIRQWFTNRCVSPQFQQIAIPNLWPTSAKEGHARSHAPQEESSNED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.07
4 0.07
5 0.05
6 0.04
7 0.04
8 0.04
9 0.03
10 0.04
11 0.04
12 0.05
13 0.06
14 0.06
15 0.07
16 0.07
17 0.08
18 0.11
19 0.14
20 0.14
21 0.2
22 0.24
23 0.26
24 0.3
25 0.31
26 0.32
27 0.37
28 0.45
29 0.45
30 0.47
31 0.46
32 0.49
33 0.49
34 0.5
35 0.46
36 0.43
37 0.43
38 0.4
39 0.39
40 0.36
41 0.38
42 0.34
43 0.32
44 0.28
45 0.25
46 0.23
47 0.3
48 0.37
49 0.42
50 0.52
51 0.59
52 0.67
53 0.72
54 0.81
55 0.83
56 0.82
57 0.82
58 0.82
59 0.81
60 0.79
61 0.76
62 0.7
63 0.61
64 0.52
65 0.44
66 0.33
67 0.24
68 0.18
69 0.13
70 0.09
71 0.08
72 0.09
73 0.1
74 0.11
75 0.11
76 0.11
77 0.11
78 0.11
79 0.15
80 0.13
81 0.11
82 0.1
83 0.1
84 0.1
85 0.09
86 0.09
87 0.05
88 0.05
89 0.05
90 0.07
91 0.07
92 0.08
93 0.07
94 0.07
95 0.07
96 0.1
97 0.1
98 0.09
99 0.11
100 0.12
101 0.13
102 0.17
103 0.2
104 0.19
105 0.18
106 0.18
107 0.16
108 0.16
109 0.18
110 0.15
111 0.15
112 0.17
113 0.18
114 0.19
115 0.21
116 0.2
117 0.18
118 0.18
119 0.15
120 0.13
121 0.15
122 0.14
123 0.12
124 0.14
125 0.13
126 0.15
127 0.14
128 0.13
129 0.1
130 0.1
131 0.1
132 0.08
133 0.08
134 0.05
135 0.05
136 0.05
137 0.05
138 0.07
139 0.07
140 0.07
141 0.09
142 0.09
143 0.11
144 0.13
145 0.2
146 0.24
147 0.3
148 0.33
149 0.34
150 0.41
151 0.41
152 0.41
153 0.36
154 0.3
155 0.24
156 0.2
157 0.18
158 0.11
159 0.09
160 0.07
161 0.06
162 0.07
163 0.06
164 0.06
165 0.07
166 0.07
167 0.07
168 0.06
169 0.07
170 0.07
171 0.07
172 0.08
173 0.08
174 0.09
175 0.13
176 0.14
177 0.14
178 0.18
179 0.18
180 0.2
181 0.2
182 0.2
183 0.17
184 0.18
185 0.21
186 0.17
187 0.18
188 0.16
189 0.16
190 0.16
191 0.15
192 0.17
193 0.14
194 0.15
195 0.14
196 0.14
197 0.14
198 0.17
199 0.21
200 0.18
201 0.18
202 0.19
203 0.21
204 0.22
205 0.22
206 0.19
207 0.17
208 0.16
209 0.16
210 0.14
211 0.13
212 0.1
213 0.1
214 0.11
215 0.08
216 0.11
217 0.1
218 0.1
219 0.09
220 0.14
221 0.13
222 0.13
223 0.14
224 0.12
225 0.12
226 0.12
227 0.13
228 0.08
229 0.08
230 0.08
231 0.08
232 0.07
233 0.07
234 0.08
235 0.08
236 0.09
237 0.09
238 0.11
239 0.13
240 0.15
241 0.19
242 0.22
243 0.27
244 0.32
245 0.35
246 0.39
247 0.39
248 0.37
249 0.38
250 0.36
251 0.36
252 0.39
253 0.37
254 0.36
255 0.4
256 0.41
257 0.38
258 0.43
259 0.46
260 0.44
261 0.52
262 0.48
263 0.47
264 0.51
265 0.53
266 0.51
267 0.5
268 0.47
269 0.37
270 0.4
271 0.39
272 0.39
273 0.36
274 0.32
275 0.25
276 0.23
277 0.23
278 0.2
279 0.19
280 0.22
281 0.24
282 0.24
283 0.31
284 0.34
285 0.39
286 0.44
287 0.44
288 0.4
289 0.47
290 0.5
291 0.46
292 0.45
293 0.44