Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O43058

Protein Details
Accession O43058    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
609-630DFNSNRKVSPVKREVRRKYISSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001766  Fork_head_dom  
IPR030456  TF_fork_head_CS_2  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0000785  C:chromatin  
GO:0097221  C:M/G1 phase-specific MADS box-forkhead transcription factor complex  
GO:0005634  C:nucleus  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0000917  P:division septum assembly  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG spo:SPBC4C3.12  -  
Pfam View protein in Pfam  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS00658  FORK_HEAD_2  
PS50039  FORK_HEAD_3  
CDD cd00059  FH_FOX  
Amino Acid Sequences MNFNSTNPYYFTHEKNLNNASKYSELPIAYQEIPLQSLPPYPKVASKLKGVVAGGKENNIASFQKPSSKATRPYIPSYTRLTYSVPPLPIPPPSEQSLDTIIYRNPSVSSSQSQEPEEFFLPLDDGKKPPYSYAMLIGMSIIRSPDRRLTLSAIYDWISNTFSFYNKSNNGWQNSIRHNLSLNKAFMKIERPRNLPGKGHFWSIRPGHEEQFLKLKLRKPGVNSRPAPPVQDVTSSTKYGSSTGSSGFNTFNTSPHIFNQRHQYLQNYYTASLTNIPTISNVNATNFHPLHSQQPYVDTPGIDAPSDLEAKFSDLGVSSVVSVTSPLQSCTNSPSPPLSSPASSASPSESLRNESLGIKSAKSLGLNKDDAPVEGPPVSHLEKDVETPSVHDSVLGFNDTVTNLGKKGLKDGTTNTLQIPAVRLPSLPSSPTIKNPSGLLLKRSNSIDFPTPPKALCPKLFCFRDDIVADDYTKFSLLSPIRSDMSGISASPNTNLKEHRTRILQMLATPDAKQLSSLTSSDAEFWSVTPLKSSILRNGDASKQVTLSESPKGDSLLDGGSLSYFTNNISSVAGLETPSKLPMSKSFDTFEDDFLDPMDMLSFENHFSDFNSNRKVSPVKREVRRKYISSATTIHSSAAQDDTYLPSPTKRKMPLLRQTSTLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.58
4 0.57
5 0.55
6 0.52
7 0.48
8 0.44
9 0.43
10 0.38
11 0.34
12 0.28
13 0.27
14 0.28
15 0.28
16 0.26
17 0.25
18 0.24
19 0.2
20 0.21
21 0.2
22 0.18
23 0.14
24 0.2
25 0.22
26 0.24
27 0.27
28 0.26
29 0.31
30 0.37
31 0.43
32 0.41
33 0.44
34 0.46
35 0.44
36 0.47
37 0.42
38 0.42
39 0.37
40 0.41
41 0.35
42 0.31
43 0.3
44 0.27
45 0.26
46 0.24
47 0.22
48 0.16
49 0.21
50 0.21
51 0.28
52 0.31
53 0.35
54 0.41
55 0.47
56 0.54
57 0.55
58 0.62
59 0.6
60 0.64
61 0.67
62 0.63
63 0.59
64 0.58
65 0.55
66 0.47
67 0.43
68 0.4
69 0.35
70 0.38
71 0.39
72 0.34
73 0.31
74 0.32
75 0.32
76 0.33
77 0.33
78 0.3
79 0.28
80 0.3
81 0.32
82 0.3
83 0.3
84 0.29
85 0.27
86 0.25
87 0.23
88 0.21
89 0.21
90 0.21
91 0.19
92 0.16
93 0.16
94 0.17
95 0.19
96 0.22
97 0.24
98 0.29
99 0.31
100 0.32
101 0.33
102 0.31
103 0.31
104 0.28
105 0.24
106 0.19
107 0.16
108 0.15
109 0.15
110 0.16
111 0.14
112 0.15
113 0.17
114 0.21
115 0.21
116 0.22
117 0.24
118 0.25
119 0.24
120 0.26
121 0.25
122 0.21
123 0.21
124 0.2
125 0.16
126 0.13
127 0.12
128 0.09
129 0.08
130 0.1
131 0.13
132 0.18
133 0.22
134 0.24
135 0.26
136 0.29
137 0.31
138 0.32
139 0.3
140 0.26
141 0.23
142 0.21
143 0.19
144 0.16
145 0.13
146 0.11
147 0.12
148 0.11
149 0.12
150 0.13
151 0.15
152 0.21
153 0.22
154 0.26
155 0.32
156 0.38
157 0.41
158 0.42
159 0.44
160 0.43
161 0.46
162 0.49
163 0.42
164 0.36
165 0.36
166 0.37
167 0.39
168 0.38
169 0.35
170 0.31
171 0.31
172 0.31
173 0.29
174 0.32
175 0.35
176 0.39
177 0.44
178 0.46
179 0.51
180 0.57
181 0.6
182 0.56
183 0.52
184 0.5
185 0.44
186 0.47
187 0.42
188 0.37
189 0.4
190 0.38
191 0.37
192 0.34
193 0.35
194 0.31
195 0.35
196 0.35
197 0.29
198 0.35
199 0.33
200 0.33
201 0.35
202 0.38
203 0.39
204 0.43
205 0.45
206 0.43
207 0.53
208 0.56
209 0.61
210 0.59
211 0.55
212 0.57
213 0.55
214 0.51
215 0.42
216 0.36
217 0.28
218 0.28
219 0.27
220 0.27
221 0.29
222 0.27
223 0.25
224 0.24
225 0.23
226 0.21
227 0.19
228 0.13
229 0.12
230 0.13
231 0.15
232 0.13
233 0.15
234 0.14
235 0.13
236 0.16
237 0.15
238 0.15
239 0.17
240 0.19
241 0.19
242 0.21
243 0.29
244 0.26
245 0.29
246 0.38
247 0.36
248 0.37
249 0.36
250 0.37
251 0.33
252 0.34
253 0.35
254 0.26
255 0.24
256 0.22
257 0.21
258 0.18
259 0.16
260 0.15
261 0.12
262 0.11
263 0.1
264 0.1
265 0.11
266 0.11
267 0.1
268 0.1
269 0.1
270 0.12
271 0.12
272 0.18
273 0.17
274 0.18
275 0.17
276 0.18
277 0.22
278 0.22
279 0.23
280 0.16
281 0.2
282 0.2
283 0.21
284 0.21
285 0.16
286 0.14
287 0.15
288 0.15
289 0.11
290 0.1
291 0.08
292 0.09
293 0.1
294 0.09
295 0.08
296 0.07
297 0.09
298 0.09
299 0.08
300 0.07
301 0.06
302 0.06
303 0.06
304 0.06
305 0.05
306 0.04
307 0.04
308 0.04
309 0.04
310 0.04
311 0.06
312 0.07
313 0.07
314 0.09
315 0.09
316 0.1
317 0.14
318 0.17
319 0.15
320 0.16
321 0.17
322 0.18
323 0.19
324 0.22
325 0.18
326 0.15
327 0.16
328 0.18
329 0.17
330 0.16
331 0.15
332 0.13
333 0.14
334 0.14
335 0.15
336 0.13
337 0.15
338 0.15
339 0.15
340 0.15
341 0.14
342 0.14
343 0.16
344 0.16
345 0.13
346 0.13
347 0.14
348 0.14
349 0.14
350 0.17
351 0.16
352 0.2
353 0.21
354 0.21
355 0.22
356 0.21
357 0.2
358 0.18
359 0.15
360 0.12
361 0.11
362 0.11
363 0.08
364 0.11
365 0.12
366 0.11
367 0.11
368 0.12
369 0.12
370 0.14
371 0.14
372 0.12
373 0.11
374 0.13
375 0.14
376 0.13
377 0.12
378 0.11
379 0.1
380 0.09
381 0.1
382 0.1
383 0.08
384 0.06
385 0.07
386 0.07
387 0.08
388 0.08
389 0.07
390 0.07
391 0.1
392 0.13
393 0.12
394 0.17
395 0.19
396 0.2
397 0.22
398 0.24
399 0.27
400 0.26
401 0.27
402 0.23
403 0.22
404 0.2
405 0.19
406 0.19
407 0.15
408 0.14
409 0.13
410 0.13
411 0.12
412 0.15
413 0.16
414 0.14
415 0.15
416 0.18
417 0.2
418 0.25
419 0.3
420 0.28
421 0.28
422 0.27
423 0.29
424 0.31
425 0.31
426 0.3
427 0.3
428 0.3
429 0.33
430 0.34
431 0.31
432 0.25
433 0.27
434 0.27
435 0.24
436 0.28
437 0.3
438 0.29
439 0.28
440 0.31
441 0.33
442 0.34
443 0.36
444 0.37
445 0.37
446 0.45
447 0.47
448 0.44
449 0.44
450 0.39
451 0.39
452 0.34
453 0.31
454 0.25
455 0.24
456 0.24
457 0.19
458 0.19
459 0.14
460 0.13
461 0.11
462 0.08
463 0.14
464 0.15
465 0.18
466 0.2
467 0.23
468 0.23
469 0.23
470 0.24
471 0.16
472 0.18
473 0.15
474 0.12
475 0.12
476 0.12
477 0.13
478 0.14
479 0.18
480 0.16
481 0.19
482 0.21
483 0.26
484 0.34
485 0.37
486 0.4
487 0.41
488 0.41
489 0.43
490 0.45
491 0.4
492 0.32
493 0.34
494 0.32
495 0.28
496 0.26
497 0.24
498 0.2
499 0.18
500 0.17
501 0.13
502 0.13
503 0.14
504 0.14
505 0.14
506 0.14
507 0.15
508 0.16
509 0.15
510 0.14
511 0.12
512 0.12
513 0.15
514 0.16
515 0.16
516 0.16
517 0.16
518 0.17
519 0.22
520 0.24
521 0.26
522 0.29
523 0.3
524 0.31
525 0.33
526 0.35
527 0.36
528 0.35
529 0.29
530 0.24
531 0.23
532 0.23
533 0.22
534 0.21
535 0.22
536 0.21
537 0.21
538 0.21
539 0.22
540 0.2
541 0.17
542 0.16
543 0.11
544 0.11
545 0.1
546 0.09
547 0.08
548 0.08
549 0.08
550 0.07
551 0.06
552 0.06
553 0.08
554 0.08
555 0.09
556 0.09
557 0.09
558 0.09
559 0.1
560 0.1
561 0.09
562 0.1
563 0.11
564 0.12
565 0.13
566 0.14
567 0.13
568 0.16
569 0.23
570 0.3
571 0.31
572 0.33
573 0.35
574 0.35
575 0.4
576 0.39
577 0.33
578 0.29
579 0.27
580 0.23
581 0.21
582 0.21
583 0.14
584 0.13
585 0.12
586 0.08
587 0.08
588 0.09
589 0.1
590 0.09
591 0.11
592 0.11
593 0.11
594 0.12
595 0.19
596 0.22
597 0.28
598 0.35
599 0.35
600 0.36
601 0.41
602 0.48
603 0.46
604 0.53
605 0.57
606 0.59
607 0.68
608 0.78
609 0.82
610 0.84
611 0.85
612 0.78
613 0.75
614 0.75
615 0.68
616 0.62
617 0.57
618 0.5
619 0.46
620 0.43
621 0.36
622 0.29
623 0.27
624 0.24
625 0.22
626 0.18
627 0.14
628 0.15
629 0.2
630 0.2
631 0.21
632 0.2
633 0.25
634 0.31
635 0.36
636 0.43
637 0.45
638 0.52
639 0.6
640 0.7
641 0.73
642 0.76
643 0.74