FuNGI

O43058

Protein Details

Accession

O43058

Localization Confidence

Medium

Confidence Score

13.5

NoLS Segment(s)

Position	Sequence	Protein Nature
609-630	DFNSNRKVSPVKREVRRKYISS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 23, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR001766 Fork_head_dom IPR030456 TF_fork_head_CS_2 IPR036388 WH-like_DNA-bd_sf IPR036390 WH_DNA-bd_sf
Gene Ontology	GO:0000785 C:chromatin GO:0097221 C:M/G1 phase-specific MADS box-forkhead transcription factor complex GO:0005634 C:nucleus GO:0001228 F:DNA-binding transcription activator activity, RNA polymerase II-specific GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0000978 F:RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000917 P:division septum assembly GO:0000122 P:negative regulation of transcription by RNA polymerase II GO:0045944 P:positive regulation of transcription by RNA polymerase II GO:0006357 P:regulation of transcription by RNA polymerase II
KEGG	spo:SPBC4C3.12 -
Pfam	View protein in Pfam PF00250 Forkhead
PROSITE	View protein in PROSITE PS00658 FORK_HEAD_2 PS50039 FORK_HEAD_3
CDD	cd00059 FH_FOX

Amino Acid Sequences

MNFNSTNPYYFTHEKNLNNASKYSELPIAYQEIPLQSLPPYPKVASKLKGVVAGGKENNIASFQKPSSKATRPYIPSYTRLTYSVPPLPIPPPSEQSLDTIIYRNPSVSSSQSQEPEEFFLPLDDGKKPPYSYAMLIGMSIIRSPDRRLTLSAIYDWISNTFSFYNKSNNGWQNSIRHNLSLNKAFMKIERPRNLPGKGHFWSIRPGHEEQFLKLKLRKPGVNSRPAPPVQDVTSSTKYGSSTGSSGFNTFNTSPHIFNQRHQYLQNYYTASLTNIPTISNVNATNFHPLHSQQPYVDTPGIDAPSDLEAKFSDLGVSSVVSVTSPLQSCTNSPSPPLSSPASSASPSESLRNESLGIKSAKSLGLNKDDAPVEGPPVSHLEKDVETPSVHDSVLGFNDTVTNLGKKGLKDGTTNTLQIPAVRLPSLPSSPTIKNPSGLLLKRSNSIDFPTPPKALCPKLFCFRDDIVADDYTKFSLLSPIRSDMSGISASPNTNLKEHRTRILQMLATPDAKQLSSLTSSDAEFWSVTPLKSSILRNGDASKQVTLSESPKGDSLLDGGSLSYFTNNISSVAGLETPSKLPMSKSFDTFEDDFLDPMDMLSFENHFSDFNSNRKVSPVKREVRRKYISSATTIHSSAAQDDTYLPSPTKRKMPLLRQTSTLF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.47
2	0.52
3	0.58
4	0.57
5	0.55
6	0.52
7	0.48
8	0.44
9	0.43
10	0.38
11	0.34
12	0.28
13	0.27
14	0.28
15	0.28
16	0.26
17	0.25
18	0.24
19	0.2
20	0.21
21	0.2
22	0.18
23	0.14
24	0.2
25	0.22
26	0.24
27	0.27
28	0.26
29	0.31
30	0.37
31	0.43
32	0.41
33	0.44
34	0.46
35	0.44
36	0.47
37	0.42
38	0.42
39	0.37
40	0.41
41	0.35
42	0.31
43	0.3
44	0.27
45	0.26
46	0.24
47	0.22
48	0.16
49	0.21
50	0.21
51	0.28
52	0.31
53	0.35
54	0.41
55	0.47
56	0.54
57	0.55
58	0.62
59	0.6
60	0.64
61	0.67
62	0.63
63	0.59
64	0.58
65	0.55
66	0.47
67	0.43
68	0.4
69	0.35
70	0.38
71	0.39
72	0.34
73	0.31
74	0.32
75	0.32
76	0.33
77	0.33
78	0.3
79	0.28
80	0.3
81	0.32
82	0.3
83	0.3
84	0.29
85	0.27
86	0.25
87	0.23
88	0.21
89	0.21
90	0.21
91	0.19
92	0.16
93	0.16
94	0.17
95	0.19
96	0.22
97	0.24
98	0.29
99	0.31
100	0.32
101	0.33
102	0.31
103	0.31
104	0.28
105	0.24
106	0.19
107	0.16
108	0.15
109	0.15
110	0.16
111	0.14
112	0.15
113	0.17
114	0.21
115	0.21
116	0.22
117	0.24
118	0.25
119	0.24
120	0.26
121	0.25
122	0.21
123	0.21
124	0.2
125	0.16
126	0.13
127	0.12
128	0.09
129	0.08
130	0.1
131	0.13
132	0.18
133	0.22
134	0.24
135	0.26
136	0.29
137	0.31
138	0.32
139	0.3
140	0.26
141	0.23
142	0.21
143	0.19
144	0.16
145	0.13
146	0.11
147	0.12
148	0.11
149	0.12
150	0.13
151	0.15
152	0.21
153	0.22
154	0.26
155	0.32
156	0.38
157	0.41
158	0.42
159	0.44
160	0.43
161	0.46
162	0.49
163	0.42
164	0.36
165	0.36
166	0.37
167	0.39
168	0.38
169	0.35
170	0.31
171	0.31
172	0.31
173	0.29
174	0.32
175	0.35
176	0.39
177	0.44
178	0.46
179	0.51
180	0.57
181	0.6
182	0.56
183	0.52
184	0.5
185	0.44
186	0.47
187	0.42
188	0.37
189	0.4
190	0.38
191	0.37
192	0.34
193	0.35
194	0.31
195	0.35
196	0.35
197	0.29
198	0.35
199	0.33
200	0.33
201	0.35
202	0.38
203	0.39
204	0.43
205	0.45
206	0.43
207	0.53
208	0.56
209	0.61
210	0.59
211	0.55
212	0.57
213	0.55
214	0.51
215	0.42
216	0.36
217	0.28
218	0.28
219	0.27
220	0.27
221	0.29
222	0.27
223	0.25
224	0.24
225	0.23
226	0.21
227	0.19
228	0.13
229	0.12
230	0.13
231	0.15
232	0.13
233	0.15
234	0.14
235	0.13
236	0.16
237	0.15
238	0.15
239	0.17
240	0.19
241	0.19
242	0.21
243	0.29
244	0.26
245	0.29
246	0.38
247	0.36
248	0.37
249	0.36
250	0.37
251	0.33
252	0.34
253	0.35
254	0.26
255	0.24
256	0.22
257	0.21
258	0.18
259	0.16
260	0.15
261	0.12
262	0.11
263	0.1
264	0.1
265	0.11
266	0.11
267	0.1
268	0.1
269	0.1
270	0.12
271	0.12
272	0.18
273	0.17
274	0.18
275	0.17
276	0.18
277	0.22
278	0.22
279	0.23
280	0.16
281	0.2
282	0.2
283	0.21
284	0.21
285	0.16
286	0.14
287	0.15
288	0.15
289	0.11
290	0.1
291	0.08
292	0.09
293	0.1
294	0.09
295	0.08
296	0.07
297	0.09
298	0.09
299	0.08
300	0.07
301	0.06
302	0.06
303	0.06
304	0.06
305	0.05
306	0.04
307	0.04
308	0.04
309	0.04
310	0.04
311	0.06
312	0.07
313	0.07
314	0.09
315	0.09
316	0.1
317	0.14
318	0.17
319	0.15
320	0.16
321	0.17
322	0.18
323	0.19
324	0.22
325	0.18
326	0.15
327	0.16
328	0.18
329	0.17
330	0.16
331	0.15
332	0.13
333	0.14
334	0.14
335	0.15
336	0.13
337	0.15
338	0.15
339	0.15
340	0.15
341	0.14
342	0.14
343	0.16
344	0.16
345	0.13
346	0.13
347	0.14
348	0.14
349	0.14
350	0.17
351	0.16
352	0.2
353	0.21
354	0.21
355	0.22
356	0.21
357	0.2
358	0.18
359	0.15
360	0.12
361	0.11
362	0.11
363	0.08
364	0.11
365	0.12
366	0.11
367	0.11
368	0.12
369	0.12
370	0.14
371	0.14
372	0.12
373	0.11
374	0.13
375	0.14
376	0.13
377	0.12
378	0.11
379	0.1
380	0.09
381	0.1
382	0.1
383	0.08
384	0.06
385	0.07
386	0.07
387	0.08
388	0.08
389	0.07
390	0.07
391	0.1
392	0.13
393	0.12
394	0.17
395	0.19
396	0.2
397	0.22
398	0.24
399	0.27
400	0.26
401	0.27
402	0.23
403	0.22
404	0.2
405	0.19
406	0.19
407	0.15
408	0.14
409	0.13
410	0.13
411	0.12
412	0.15
413	0.16
414	0.14
415	0.15
416	0.18
417	0.2
418	0.25
419	0.3
420	0.28
421	0.28
422	0.27
423	0.29
424	0.31
425	0.31
426	0.3
427	0.3
428	0.3
429	0.33
430	0.34
431	0.31
432	0.25
433	0.27
434	0.27
435	0.24
436	0.28
437	0.3
438	0.29
439	0.28
440	0.31
441	0.33
442	0.34
443	0.36
444	0.37
445	0.37
446	0.45
447	0.47
448	0.44
449	0.44
450	0.39
451	0.39
452	0.34
453	0.31
454	0.25
455	0.24
456	0.24
457	0.19
458	0.19
459	0.14
460	0.13
461	0.11
462	0.08
463	0.14
464	0.15
465	0.18
466	0.2
467	0.23
468	0.23
469	0.23
470	0.24
471	0.16
472	0.18
473	0.15
474	0.12
475	0.12
476	0.12
477	0.13
478	0.14
479	0.18
480	0.16
481	0.19
482	0.21
483	0.26
484	0.34
485	0.37
486	0.4
487	0.41
488	0.41
489	0.43
490	0.45
491	0.4
492	0.32
493	0.34
494	0.32
495	0.28
496	0.26
497	0.24
498	0.2
499	0.18
500	0.17
501	0.13
502	0.13
503	0.14
504	0.14
505	0.14
506	0.14
507	0.15
508	0.16
509	0.15
510	0.14
511	0.12
512	0.12
513	0.15
514	0.16
515	0.16
516	0.16
517	0.16
518	0.17
519	0.22
520	0.24
521	0.26
522	0.29
523	0.3
524	0.31
525	0.33
526	0.35
527	0.36
528	0.35
529	0.29
530	0.24
531	0.23
532	0.23
533	0.22
534	0.21
535	0.22
536	0.21
537	0.21
538	0.21
539	0.22
540	0.2
541	0.17
542	0.16
543	0.11
544	0.11
545	0.1
546	0.09
547	0.08
548	0.08
549	0.08
550	0.07
551	0.06
552	0.06
553	0.08
554	0.08
555	0.09
556	0.09
557	0.09
558	0.09
559	0.1
560	0.1
561	0.09
562	0.1
563	0.11
564	0.12
565	0.13
566	0.14
567	0.13
568	0.16
569	0.23
570	0.3
571	0.31
572	0.33
573	0.35
574	0.35
575	0.4
576	0.39
577	0.33
578	0.29
579	0.27
580	0.23
581	0.21
582	0.21
583	0.14
584	0.13
585	0.12
586	0.08
587	0.08
588	0.09
589	0.1
590	0.09
591	0.11
592	0.11
593	0.11
594	0.12
595	0.19
596	0.22
597	0.28
598	0.35
599	0.35
600	0.36
601	0.41
602	0.48
603	0.46
604	0.53
605	0.57
606	0.59
607	0.68
608	0.78
609	0.82
610	0.84
611	0.85
612	0.78
613	0.75
614	0.75
615	0.68
616	0.62
617	0.57
618	0.5
619	0.46
620	0.43
621	0.36
622	0.29
623	0.27
624	0.24
625	0.22
626	0.18
627	0.14
628	0.15
629	0.2
630	0.2
631	0.21
632	0.2
633	0.25
634	0.31
635	0.36
636	0.43
637	0.45
638	0.52
639	0.6
640	0.7
641	0.73
642	0.76
643	0.74

O43058

3D AlphaFold-predicted Structure Viewer