Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SPK0

Protein Details
Accession R7SPK0    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPHKRAKRSMREKQRTESGSBasic
64-85EGSAGPSRKKRKRDEGAGKSEGBasic
NLS Segment(s)
PositionSequence
66-94SAGPSRKKRKRDEGAGKSEGGGEGEGRKK
210-218KKLPRKAKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR026680  CCDC137  
KEGG dsq:DICSQDRAFT_157021  -  
Amino Acid Sequences MPHKRAKRSMREKQRTESGSDLAPGAKKAIENEEIPKSAARVLNAAKVQQEFAERKRKGLDSDEGSAGPSRKKRKRDEGAGKSEGGGEGEGRKKAQLRIMAGESMAHFNRRVEDSMRHLVKEAIQTSSARVRQAKKEELASQGSKKAAAAASKSRATSDQARDDEDSEDEDGRPAARAKAKETGPKEFQKVDTSAPRRLNDVAQAPPELKKLPRKAKKLAAMGGGTNASGATSLKDGVLSMAQKAMMEEERERAIRLYREMKKGKSVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.78
3 0.72
4 0.65
5 0.56
6 0.47
7 0.41
8 0.34
9 0.26
10 0.25
11 0.2
12 0.17
13 0.16
14 0.15
15 0.17
16 0.21
17 0.22
18 0.23
19 0.28
20 0.31
21 0.31
22 0.31
23 0.29
24 0.24
25 0.26
26 0.25
27 0.21
28 0.21
29 0.22
30 0.28
31 0.29
32 0.29
33 0.27
34 0.26
35 0.26
36 0.22
37 0.27
38 0.24
39 0.3
40 0.39
41 0.36
42 0.38
43 0.43
44 0.44
45 0.41
46 0.42
47 0.43
48 0.37
49 0.41
50 0.4
51 0.35
52 0.33
53 0.32
54 0.28
55 0.25
56 0.27
57 0.34
58 0.4
59 0.49
60 0.58
61 0.66
62 0.74
63 0.8
64 0.84
65 0.84
66 0.85
67 0.79
68 0.69
69 0.59
70 0.49
71 0.38
72 0.27
73 0.17
74 0.09
75 0.11
76 0.13
77 0.14
78 0.14
79 0.15
80 0.18
81 0.2
82 0.24
83 0.25
84 0.24
85 0.27
86 0.29
87 0.27
88 0.24
89 0.22
90 0.18
91 0.17
92 0.15
93 0.12
94 0.11
95 0.11
96 0.13
97 0.14
98 0.15
99 0.15
100 0.18
101 0.23
102 0.3
103 0.31
104 0.29
105 0.28
106 0.26
107 0.26
108 0.27
109 0.22
110 0.15
111 0.15
112 0.15
113 0.16
114 0.21
115 0.2
116 0.18
117 0.22
118 0.24
119 0.29
120 0.35
121 0.37
122 0.34
123 0.35
124 0.35
125 0.35
126 0.35
127 0.31
128 0.27
129 0.26
130 0.24
131 0.21
132 0.18
133 0.17
134 0.14
135 0.13
136 0.14
137 0.16
138 0.2
139 0.22
140 0.22
141 0.21
142 0.21
143 0.23
144 0.27
145 0.28
146 0.31
147 0.31
148 0.33
149 0.33
150 0.33
151 0.31
152 0.24
153 0.2
154 0.14
155 0.13
156 0.11
157 0.11
158 0.09
159 0.09
160 0.09
161 0.09
162 0.12
163 0.16
164 0.17
165 0.2
166 0.27
167 0.3
168 0.37
169 0.4
170 0.43
171 0.45
172 0.48
173 0.49
174 0.44
175 0.43
176 0.4
177 0.38
178 0.36
179 0.39
180 0.39
181 0.43
182 0.46
183 0.44
184 0.42
185 0.42
186 0.39
187 0.34
188 0.34
189 0.3
190 0.26
191 0.27
192 0.25
193 0.25
194 0.26
195 0.23
196 0.24
197 0.3
198 0.39
199 0.48
200 0.57
201 0.62
202 0.69
203 0.75
204 0.78
205 0.76
206 0.7
207 0.65
208 0.57
209 0.5
210 0.44
211 0.35
212 0.26
213 0.19
214 0.14
215 0.08
216 0.07
217 0.07
218 0.06
219 0.07
220 0.07
221 0.07
222 0.08
223 0.08
224 0.09
225 0.12
226 0.12
227 0.12
228 0.13
229 0.13
230 0.13
231 0.13
232 0.15
233 0.15
234 0.18
235 0.18
236 0.2
237 0.25
238 0.25
239 0.26
240 0.25
241 0.28
242 0.29
243 0.35
244 0.41
245 0.45
246 0.55
247 0.61
248 0.62