Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SRP3

Protein Details
Accession R7SRP3    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-29SSSPYGRTHVWKRRQKKLPNPMVPVFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 11.333, nucl 8, cyto_nucl 5.666, cyto_pero 2.833, pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG dsq:DICSQDRAFT_14843  -  
Amino Acid Sequences RAVSSSPYGRTHVWKRRQKKLPNPMVPVFPQRLVRVDGSTIVHWTTSPRSVIRLTRDTTNNPLWNAARFVGMDEEEDEVTGRMGRFSRRFADLGGQKSDLDWLDEAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.77
4 0.85
5 0.86
6 0.87
7 0.88
8 0.88
9 0.87
10 0.86
11 0.78
12 0.72
13 0.65
14 0.6
15 0.51
16 0.43
17 0.37
18 0.31
19 0.31
20 0.29
21 0.27
22 0.23
23 0.2
24 0.2
25 0.18
26 0.17
27 0.15
28 0.13
29 0.11
30 0.1
31 0.11
32 0.11
33 0.11
34 0.13
35 0.12
36 0.14
37 0.17
38 0.2
39 0.24
40 0.26
41 0.25
42 0.28
43 0.31
44 0.31
45 0.34
46 0.36
47 0.33
48 0.29
49 0.3
50 0.26
51 0.25
52 0.24
53 0.19
54 0.15
55 0.12
56 0.13
57 0.11
58 0.11
59 0.1
60 0.09
61 0.1
62 0.09
63 0.09
64 0.09
65 0.07
66 0.07
67 0.08
68 0.08
69 0.08
70 0.1
71 0.17
72 0.2
73 0.24
74 0.27
75 0.3
76 0.3
77 0.3
78 0.38
79 0.37
80 0.39
81 0.39
82 0.36
83 0.32
84 0.32
85 0.34
86 0.25
87 0.21