Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SJ72

Protein Details
Accession R7SJ72    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-63LAVYFVRRHMRRKKAQERVEEISHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, mito 7, plas 6, E.R. 4, cyto_mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG dsq:DICSQDRAFT_157996  -  
Amino Acid Sequences MSTTATPSPSANVSSSQSHSATALALGISLAVVASIVFGGLAVYFVRRHMRRKKAQERVEEISSHRRTYMVSVDPSHLAARVTPFGVGVNAPDVEVPKFVHTPGENMRVAYRRSDGGWSFHQTTPQPSVDLQREATTSTMFRLCPSQGGTKEKKLRPGELTTRGYVEPDVEGNPPPAYYHDESVFSDSTSNAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.28
4 0.27
5 0.25
6 0.24
7 0.21
8 0.18
9 0.14
10 0.12
11 0.07
12 0.07
13 0.06
14 0.05
15 0.04
16 0.04
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.03
29 0.03
30 0.05
31 0.05
32 0.08
33 0.16
34 0.2
35 0.29
36 0.39
37 0.49
38 0.58
39 0.69
40 0.78
41 0.8
42 0.85
43 0.84
44 0.82
45 0.77
46 0.7
47 0.6
48 0.52
49 0.52
50 0.47
51 0.38
52 0.31
53 0.26
54 0.23
55 0.24
56 0.27
57 0.21
58 0.21
59 0.22
60 0.23
61 0.23
62 0.24
63 0.21
64 0.16
65 0.12
66 0.1
67 0.1
68 0.09
69 0.09
70 0.08
71 0.08
72 0.07
73 0.08
74 0.07
75 0.05
76 0.06
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.07
83 0.07
84 0.08
85 0.08
86 0.08
87 0.11
88 0.1
89 0.13
90 0.16
91 0.21
92 0.2
93 0.2
94 0.22
95 0.23
96 0.23
97 0.22
98 0.19
99 0.15
100 0.15
101 0.19
102 0.18
103 0.18
104 0.21
105 0.24
106 0.27
107 0.27
108 0.3
109 0.27
110 0.29
111 0.3
112 0.27
113 0.23
114 0.2
115 0.24
116 0.24
117 0.26
118 0.23
119 0.2
120 0.2
121 0.19
122 0.19
123 0.15
124 0.12
125 0.12
126 0.14
127 0.12
128 0.13
129 0.15
130 0.15
131 0.16
132 0.19
133 0.24
134 0.27
135 0.36
136 0.4
137 0.46
138 0.56
139 0.56
140 0.62
141 0.59
142 0.6
143 0.57
144 0.61
145 0.6
146 0.59
147 0.6
148 0.52
149 0.51
150 0.45
151 0.41
152 0.32
153 0.25
154 0.17
155 0.15
156 0.15
157 0.13
158 0.15
159 0.16
160 0.16
161 0.15
162 0.14
163 0.15
164 0.21
165 0.22
166 0.25
167 0.25
168 0.27
169 0.29
170 0.33
171 0.31
172 0.24
173 0.22