Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7T1H3

Protein Details
Accession R7T1H3    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
298-320GEDGGGPKKKKKKDGPGVTARNMBasic
NLS Segment(s)
PositionSequence
303-312GPKKKKKKDG
Subcellular Location(s) nucl 15.5, cyto_nucl 10, pero 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045144  TAF4  
IPR007900  TAF4_C  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0006352  P:DNA-templated transcription initiation  
KEGG dsq:DICSQDRAFT_58605  -  
Pfam View protein in Pfam  
PF05236  TAF4  
CDD cd08045  TAF4  
Amino Acid Sequences MKAEDSQQSPPTTTTFSAATWPTAKIPIDPALQQQSQHPQHTATTPYSHYQYGHYQTNYSHYPQYTQQTHQTQTAPATQAQAHVQTPQVAQTNVSTVVRPLAQAVPQTQTQSQSGVDTTDVATLNDALGSAGVDLRAEEETLQRTNDQYYSYRPYEDRSRKQPDKPHFDTMYLGSKMRATGTTHKVSTVSKESIDYVALALRFRLQGLITAMIAAARHRTDTQFDRPPSTYEDGTPMWSIKVRSDVGKQLEALQKAYREEDMKERRERKERQDAQAAQAAALTTTASGAGTDAAAADGEDGGGPKKKKKKDGPGVTARNMSEDVRKKMSNAVASQAAGLGTGKYAWMSAASAATAAPPKPKPAVAARASTPATTTTPAASSTSAGGWARPYQPKSASQQAQKDDDGRLAVTLRDAVFVVNNEKGHGGGRGAARGWT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.21
4 0.24
5 0.24
6 0.25
7 0.23
8 0.24
9 0.24
10 0.27
11 0.27
12 0.24
13 0.27
14 0.28
15 0.29
16 0.29
17 0.33
18 0.36
19 0.36
20 0.35
21 0.36
22 0.42
23 0.45
24 0.47
25 0.43
26 0.37
27 0.39
28 0.42
29 0.41
30 0.34
31 0.32
32 0.31
33 0.34
34 0.35
35 0.34
36 0.31
37 0.3
38 0.35
39 0.36
40 0.41
41 0.38
42 0.36
43 0.35
44 0.41
45 0.4
46 0.36
47 0.35
48 0.28
49 0.31
50 0.35
51 0.43
52 0.41
53 0.42
54 0.48
55 0.49
56 0.51
57 0.52
58 0.48
59 0.42
60 0.4
61 0.41
62 0.35
63 0.29
64 0.29
65 0.25
66 0.26
67 0.25
68 0.26
69 0.2
70 0.19
71 0.2
72 0.19
73 0.19
74 0.21
75 0.22
76 0.19
77 0.19
78 0.18
79 0.2
80 0.19
81 0.19
82 0.15
83 0.12
84 0.14
85 0.14
86 0.13
87 0.13
88 0.13
89 0.14
90 0.16
91 0.18
92 0.19
93 0.2
94 0.23
95 0.22
96 0.22
97 0.21
98 0.2
99 0.19
100 0.17
101 0.16
102 0.14
103 0.12
104 0.1
105 0.1
106 0.12
107 0.11
108 0.1
109 0.1
110 0.09
111 0.09
112 0.08
113 0.08
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.05
125 0.06
126 0.08
127 0.11
128 0.12
129 0.13
130 0.12
131 0.13
132 0.15
133 0.15
134 0.16
135 0.15
136 0.19
137 0.25
138 0.25
139 0.27
140 0.26
141 0.29
142 0.37
143 0.45
144 0.48
145 0.51
146 0.6
147 0.64
148 0.7
149 0.75
150 0.74
151 0.74
152 0.72
153 0.71
154 0.62
155 0.57
156 0.51
157 0.45
158 0.43
159 0.34
160 0.28
161 0.2
162 0.19
163 0.19
164 0.18
165 0.17
166 0.13
167 0.2
168 0.26
169 0.29
170 0.29
171 0.29
172 0.3
173 0.28
174 0.29
175 0.26
176 0.21
177 0.18
178 0.18
179 0.19
180 0.18
181 0.17
182 0.13
183 0.08
184 0.09
185 0.08
186 0.08
187 0.07
188 0.07
189 0.07
190 0.07
191 0.08
192 0.06
193 0.08
194 0.09
195 0.1
196 0.08
197 0.08
198 0.08
199 0.07
200 0.07
201 0.05
202 0.06
203 0.05
204 0.06
205 0.07
206 0.08
207 0.12
208 0.16
209 0.23
210 0.29
211 0.3
212 0.33
213 0.33
214 0.34
215 0.35
216 0.33
217 0.27
218 0.2
219 0.22
220 0.19
221 0.19
222 0.18
223 0.14
224 0.12
225 0.13
226 0.13
227 0.1
228 0.14
229 0.14
230 0.16
231 0.18
232 0.23
233 0.24
234 0.25
235 0.24
236 0.26
237 0.29
238 0.27
239 0.26
240 0.22
241 0.21
242 0.21
243 0.22
244 0.18
245 0.15
246 0.16
247 0.24
248 0.31
249 0.36
250 0.44
251 0.49
252 0.54
253 0.62
254 0.67
255 0.67
256 0.7
257 0.71
258 0.69
259 0.72
260 0.67
261 0.61
262 0.58
263 0.49
264 0.37
265 0.3
266 0.24
267 0.14
268 0.12
269 0.09
270 0.04
271 0.04
272 0.04
273 0.03
274 0.03
275 0.03
276 0.03
277 0.03
278 0.03
279 0.03
280 0.03
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.04
288 0.05
289 0.11
290 0.12
291 0.2
292 0.29
293 0.36
294 0.46
295 0.56
296 0.66
297 0.72
298 0.81
299 0.83
300 0.85
301 0.86
302 0.79
303 0.73
304 0.62
305 0.53
306 0.44
307 0.35
308 0.33
309 0.33
310 0.34
311 0.35
312 0.35
313 0.34
314 0.39
315 0.42
316 0.39
317 0.34
318 0.32
319 0.29
320 0.29
321 0.28
322 0.22
323 0.17
324 0.12
325 0.11
326 0.07
327 0.05
328 0.05
329 0.05
330 0.05
331 0.05
332 0.05
333 0.05
334 0.05
335 0.06
336 0.07
337 0.07
338 0.07
339 0.07
340 0.08
341 0.1
342 0.11
343 0.16
344 0.17
345 0.21
346 0.23
347 0.25
348 0.28
349 0.32
350 0.41
351 0.39
352 0.42
353 0.4
354 0.44
355 0.44
356 0.39
357 0.33
358 0.26
359 0.24
360 0.21
361 0.2
362 0.16
363 0.16
364 0.17
365 0.17
366 0.15
367 0.14
368 0.14
369 0.13
370 0.15
371 0.14
372 0.14
373 0.15
374 0.19
375 0.25
376 0.32
377 0.34
378 0.36
379 0.41
380 0.46
381 0.5
382 0.56
383 0.57
384 0.58
385 0.63
386 0.63
387 0.64
388 0.61
389 0.57
390 0.48
391 0.43
392 0.36
393 0.29
394 0.24
395 0.2
396 0.17
397 0.15
398 0.17
399 0.15
400 0.14
401 0.14
402 0.13
403 0.15
404 0.17
405 0.2
406 0.2
407 0.2
408 0.2
409 0.21
410 0.21
411 0.2
412 0.19
413 0.16
414 0.17
415 0.19
416 0.21