Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SXD0

Protein Details
Accession R7SXD0    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
110-134LRPRPPRPLVQERRARRKRDPSAPEBasic
NLS Segment(s)
PositionSequence
111-130RPRPPRPLVQERRARRKRDP
Subcellular Location(s) cyto 15.5, cyto_nucl 12.5, nucl 6.5, mito 4
Family & Domain DBs
KEGG dsq:DICSQDRAFT_171815  -  
Amino Acid Sequences MTTPDGNMKNLSGRQARWLEHISEFNFSIEYVPGVENVLADALSRIYSNDRPGTVRAPSEYTSFDEEGDFGSSLRTFAISVPVLVDPESVVAAEAAEAVPGPTVATTRVLRPRPPRPLVQERRARRKRDPSAPESKAHATASVPNFSVDDQAQENLPGPKGHEGTSAVAGLPLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.42
4 0.42
5 0.43
6 0.39
7 0.37
8 0.41
9 0.34
10 0.32
11 0.31
12 0.26
13 0.22
14 0.19
15 0.17
16 0.12
17 0.11
18 0.09
19 0.08
20 0.08
21 0.09
22 0.09
23 0.07
24 0.07
25 0.07
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.06
33 0.1
34 0.12
35 0.16
36 0.18
37 0.19
38 0.21
39 0.23
40 0.25
41 0.24
42 0.23
43 0.2
44 0.21
45 0.21
46 0.21
47 0.21
48 0.2
49 0.22
50 0.2
51 0.19
52 0.16
53 0.14
54 0.13
55 0.13
56 0.11
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.06
63 0.05
64 0.05
65 0.09
66 0.08
67 0.08
68 0.09
69 0.09
70 0.09
71 0.08
72 0.08
73 0.04
74 0.05
75 0.05
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.02
84 0.02
85 0.02
86 0.02
87 0.03
88 0.03
89 0.02
90 0.03
91 0.04
92 0.08
93 0.08
94 0.13
95 0.21
96 0.24
97 0.3
98 0.38
99 0.46
100 0.52
101 0.55
102 0.57
103 0.58
104 0.67
105 0.7
106 0.71
107 0.72
108 0.72
109 0.79
110 0.81
111 0.79
112 0.77
113 0.79
114 0.79
115 0.8
116 0.8
117 0.76
118 0.79
119 0.76
120 0.69
121 0.63
122 0.57
123 0.49
124 0.41
125 0.34
126 0.25
127 0.28
128 0.29
129 0.27
130 0.24
131 0.22
132 0.22
133 0.21
134 0.23
135 0.16
136 0.15
137 0.14
138 0.14
139 0.14
140 0.14
141 0.17
142 0.16
143 0.18
144 0.16
145 0.17
146 0.23
147 0.24
148 0.24
149 0.25
150 0.25
151 0.26
152 0.28
153 0.26
154 0.19