Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SGJ2

Protein Details
Accession R7SGJ2   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
41-60EDEQPRKRGARKPLRRGDVTBasic
NLS Segment(s)
PositionSequence
46-84RKRGARKPLRRGDVTAARAHKEASSGGTRAAAGRKRKGP
Subcellular Location(s) plas 13, nucl 8, cyto 3, mito 1, pero 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG dsq:DICSQDRAFT_176191  -  
Amino Acid Sequences MASEDPSGDAKSSGDSDFEPKDTDGEGEEEVDGVMDVDEDEDEQPRKRGARKPLRRGDVTAARAHKEASSGGTRAAAGRKRKGPPVMAESPELADPIRLRLIPARAPLLTLGPQHLSPMTPLTVPRHRDIATTRTARRLAPPTPSLLGILTWYVYLFLFPRDHICIANIYSGVAPIAARFDPLDMLFIGLTGAILVTASAAMLNPPAAERSARLRVAMPIAPNRAMHAAVVTGPAGRVRWSRPGAGCTTGGPAHLNVLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.19
4 0.21
5 0.22
6 0.22
7 0.2
8 0.2
9 0.19
10 0.19
11 0.15
12 0.15
13 0.14
14 0.13
15 0.12
16 0.11
17 0.1
18 0.09
19 0.07
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.06
28 0.09
29 0.11
30 0.13
31 0.15
32 0.19
33 0.24
34 0.3
35 0.37
36 0.45
37 0.54
38 0.63
39 0.72
40 0.79
41 0.82
42 0.77
43 0.74
44 0.71
45 0.68
46 0.61
47 0.56
48 0.49
49 0.44
50 0.41
51 0.38
52 0.3
53 0.22
54 0.19
55 0.17
56 0.17
57 0.16
58 0.16
59 0.15
60 0.15
61 0.16
62 0.21
63 0.23
64 0.26
65 0.33
66 0.39
67 0.43
68 0.49
69 0.52
70 0.5
71 0.49
72 0.51
73 0.5
74 0.45
75 0.42
76 0.37
77 0.33
78 0.28
79 0.23
80 0.15
81 0.1
82 0.08
83 0.09
84 0.1
85 0.09
86 0.1
87 0.13
88 0.16
89 0.17
90 0.19
91 0.19
92 0.18
93 0.18
94 0.18
95 0.16
96 0.15
97 0.13
98 0.12
99 0.11
100 0.11
101 0.11
102 0.11
103 0.09
104 0.08
105 0.09
106 0.08
107 0.07
108 0.09
109 0.14
110 0.19
111 0.22
112 0.22
113 0.24
114 0.24
115 0.25
116 0.27
117 0.25
118 0.27
119 0.29
120 0.3
121 0.3
122 0.31
123 0.3
124 0.32
125 0.33
126 0.29
127 0.29
128 0.29
129 0.27
130 0.26
131 0.26
132 0.22
133 0.17
134 0.14
135 0.09
136 0.08
137 0.06
138 0.05
139 0.05
140 0.05
141 0.04
142 0.05
143 0.05
144 0.07
145 0.07
146 0.08
147 0.11
148 0.13
149 0.14
150 0.14
151 0.14
152 0.13
153 0.14
154 0.15
155 0.12
156 0.1
157 0.09
158 0.09
159 0.08
160 0.06
161 0.05
162 0.04
163 0.06
164 0.06
165 0.06
166 0.06
167 0.07
168 0.08
169 0.08
170 0.09
171 0.07
172 0.08
173 0.07
174 0.07
175 0.06
176 0.05
177 0.05
178 0.03
179 0.03
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.02
186 0.02
187 0.03
188 0.03
189 0.04
190 0.04
191 0.04
192 0.05
193 0.06
194 0.07
195 0.08
196 0.1
197 0.16
198 0.23
199 0.23
200 0.24
201 0.24
202 0.26
203 0.3
204 0.31
205 0.29
206 0.28
207 0.31
208 0.32
209 0.31
210 0.3
211 0.28
212 0.25
213 0.21
214 0.16
215 0.13
216 0.11
217 0.12
218 0.1
219 0.08
220 0.09
221 0.1
222 0.1
223 0.12
224 0.16
225 0.18
226 0.27
227 0.3
228 0.37
229 0.39
230 0.44
231 0.44
232 0.44
233 0.42
234 0.34
235 0.35
236 0.29
237 0.26
238 0.23
239 0.19