Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SQM6

Protein Details
Accession R7SQM6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
263-285IPSAVVAFRKKQKPKFGPLGPKLHydrophilic
NLS Segment(s)
PositionSequence
272-278KKQKPKF
Subcellular Location(s) mito 21.5, cyto_mito 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029045  ClpP/crotonase-like_dom_sf  
IPR045002  Ech1-like  
IPR001753  Enoyl-CoA_hydra/iso  
IPR014748  Enoyl-CoA_hydra_C  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006635  P:fatty acid beta-oxidation  
KEGG dsq:DICSQDRAFT_110002  -  
Pfam View protein in Pfam  
PF00378  ECH_1  
CDD cd06558  crotonase-like  
Amino Acid Sequences MSHPYSHISGSWVKVTSPRPHVALVELSRDPVNAFHEPFWTELGHVFDKIAEEPTIRAVVLASANSKLFSAGIDIGSLSGTLASESSPDPSRRALQLQGHIASFQASISALERCRYPVIVATHGVAYGLSIDIIAACDVRYAASSTSFAVKEVDVGLAADIGTLARLPKITGNQSLASELAFTARPFDASEALTLGLVSRVVNGGRDEVVKAALETATLIAEKSPIAVLGTKKLLLHARDHSVAENLDYTAVWNSAMLQTQDIPSAVVAFRKKQKPKFGPLGPKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.4
4 0.43
5 0.44
6 0.42
7 0.43
8 0.43
9 0.4
10 0.41
11 0.34
12 0.33
13 0.29
14 0.29
15 0.27
16 0.26
17 0.23
18 0.18
19 0.21
20 0.19
21 0.21
22 0.2
23 0.23
24 0.23
25 0.24
26 0.24
27 0.19
28 0.15
29 0.16
30 0.2
31 0.18
32 0.17
33 0.16
34 0.15
35 0.16
36 0.17
37 0.16
38 0.12
39 0.12
40 0.12
41 0.14
42 0.14
43 0.12
44 0.11
45 0.09
46 0.1
47 0.1
48 0.11
49 0.1
50 0.11
51 0.11
52 0.11
53 0.11
54 0.1
55 0.09
56 0.08
57 0.09
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.07
65 0.05
66 0.04
67 0.03
68 0.03
69 0.04
70 0.03
71 0.05
72 0.05
73 0.08
74 0.12
75 0.14
76 0.15
77 0.18
78 0.21
79 0.22
80 0.24
81 0.27
82 0.28
83 0.32
84 0.35
85 0.33
86 0.31
87 0.28
88 0.26
89 0.21
90 0.16
91 0.1
92 0.06
93 0.05
94 0.05
95 0.06
96 0.09
97 0.09
98 0.09
99 0.1
100 0.11
101 0.12
102 0.12
103 0.11
104 0.14
105 0.17
106 0.18
107 0.18
108 0.17
109 0.16
110 0.16
111 0.15
112 0.09
113 0.06
114 0.05
115 0.04
116 0.03
117 0.03
118 0.02
119 0.02
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.04
128 0.05
129 0.05
130 0.06
131 0.06
132 0.07
133 0.09
134 0.09
135 0.09
136 0.09
137 0.09
138 0.08
139 0.08
140 0.08
141 0.05
142 0.05
143 0.05
144 0.04
145 0.04
146 0.03
147 0.03
148 0.02
149 0.02
150 0.03
151 0.03
152 0.03
153 0.03
154 0.04
155 0.07
156 0.1
157 0.13
158 0.16
159 0.19
160 0.2
161 0.2
162 0.2
163 0.18
164 0.15
165 0.12
166 0.09
167 0.07
168 0.07
169 0.06
170 0.08
171 0.08
172 0.09
173 0.09
174 0.1
175 0.11
176 0.1
177 0.11
178 0.09
179 0.09
180 0.08
181 0.08
182 0.07
183 0.05
184 0.05
185 0.05
186 0.04
187 0.05
188 0.06
189 0.08
190 0.08
191 0.09
192 0.1
193 0.11
194 0.11
195 0.1
196 0.11
197 0.09
198 0.09
199 0.08
200 0.07
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.06
207 0.05
208 0.06
209 0.05
210 0.06
211 0.06
212 0.05
213 0.06
214 0.1
215 0.11
216 0.15
217 0.17
218 0.18
219 0.18
220 0.22
221 0.26
222 0.25
223 0.29
224 0.3
225 0.33
226 0.35
227 0.36
228 0.33
229 0.3
230 0.29
231 0.24
232 0.2
233 0.15
234 0.13
235 0.12
236 0.11
237 0.1
238 0.1
239 0.09
240 0.08
241 0.09
242 0.11
243 0.14
244 0.13
245 0.13
246 0.14
247 0.15
248 0.17
249 0.16
250 0.14
251 0.11
252 0.13
253 0.12
254 0.16
255 0.19
256 0.25
257 0.34
258 0.44
259 0.53
260 0.6
261 0.71
262 0.74
263 0.81
264 0.84
265 0.85