Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7T1I2

Protein Details
Accession R7T1I2   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSPSNHHYRRNRRRPPPTLARPSKYRTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, cyto_nucl 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
KEGG dsq:DICSQDRAFT_126907  -  
Amino Acid Sequences MSPSNHHYRRNRRRPPPTLARPSKYRTICDLPVELLCMIVSHVKSSRWTLRACTLACHCLRAVSLEHYFNTRLKVRDIRSFDHLISFLRAAPNIREKIRRLELSGQTEIGKVPHIALTSIDDTVVATLMQLLPNLTSLDINSMMYDTPASRSPPHVQQDKPGPFRLQSFSFDFYYTLSHNSSISGLFRILSLFSIDALSYSVRDFDTTSPFDLAFLHRPLEIKKLRISHCSPDENSGTSLLLDAFTESLEPESLESLRIEYGTGPEVLALGKLLARAGKALTSLSISGIHPFMLSERKPWHWVDPLNSMSMF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.91
4 0.91
5 0.91
6 0.9
7 0.86
8 0.83
9 0.8
10 0.79
11 0.73
12 0.66
13 0.62
14 0.6
15 0.57
16 0.54
17 0.5
18 0.43
19 0.38
20 0.36
21 0.28
22 0.21
23 0.16
24 0.12
25 0.1
26 0.12
27 0.12
28 0.13
29 0.15
30 0.17
31 0.19
32 0.26
33 0.33
34 0.34
35 0.35
36 0.36
37 0.41
38 0.46
39 0.43
40 0.42
41 0.38
42 0.41
43 0.4
44 0.38
45 0.32
46 0.26
47 0.26
48 0.23
49 0.22
50 0.19
51 0.23
52 0.22
53 0.23
54 0.25
55 0.27
56 0.25
57 0.28
58 0.27
59 0.25
60 0.29
61 0.36
62 0.37
63 0.44
64 0.47
65 0.46
66 0.47
67 0.48
68 0.43
69 0.38
70 0.34
71 0.27
72 0.24
73 0.21
74 0.16
75 0.15
76 0.15
77 0.14
78 0.17
79 0.24
80 0.26
81 0.29
82 0.33
83 0.34
84 0.42
85 0.47
86 0.45
87 0.41
88 0.46
89 0.48
90 0.48
91 0.47
92 0.4
93 0.33
94 0.32
95 0.28
96 0.2
97 0.15
98 0.09
99 0.08
100 0.09
101 0.09
102 0.08
103 0.09
104 0.11
105 0.11
106 0.11
107 0.1
108 0.08
109 0.08
110 0.08
111 0.07
112 0.04
113 0.03
114 0.03
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.06
122 0.05
123 0.05
124 0.05
125 0.07
126 0.07
127 0.07
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.05
134 0.06
135 0.08
136 0.1
137 0.1
138 0.14
139 0.17
140 0.24
141 0.29
142 0.33
143 0.32
144 0.35
145 0.44
146 0.47
147 0.47
148 0.43
149 0.38
150 0.34
151 0.36
152 0.34
153 0.27
154 0.23
155 0.23
156 0.24
157 0.23
158 0.23
159 0.2
160 0.17
161 0.16
162 0.14
163 0.13
164 0.11
165 0.1
166 0.1
167 0.1
168 0.1
169 0.09
170 0.09
171 0.08
172 0.08
173 0.07
174 0.07
175 0.07
176 0.07
177 0.06
178 0.06
179 0.05
180 0.06
181 0.06
182 0.06
183 0.05
184 0.06
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.07
191 0.08
192 0.09
193 0.14
194 0.15
195 0.17
196 0.17
197 0.16
198 0.16
199 0.16
200 0.17
201 0.16
202 0.16
203 0.15
204 0.15
205 0.17
206 0.18
207 0.26
208 0.27
209 0.26
210 0.3
211 0.36
212 0.38
213 0.45
214 0.47
215 0.47
216 0.5
217 0.53
218 0.49
219 0.47
220 0.46
221 0.4
222 0.37
223 0.29
224 0.23
225 0.16
226 0.16
227 0.11
228 0.09
229 0.07
230 0.06
231 0.05
232 0.05
233 0.05
234 0.05
235 0.06
236 0.06
237 0.06
238 0.06
239 0.08
240 0.08
241 0.09
242 0.09
243 0.09
244 0.09
245 0.09
246 0.09
247 0.08
248 0.1
249 0.1
250 0.1
251 0.09
252 0.09
253 0.09
254 0.09
255 0.08
256 0.07
257 0.05
258 0.06
259 0.06
260 0.07
261 0.08
262 0.08
263 0.09
264 0.1
265 0.1
266 0.11
267 0.11
268 0.11
269 0.12
270 0.12
271 0.12
272 0.14
273 0.13
274 0.15
275 0.15
276 0.14
277 0.12
278 0.12
279 0.13
280 0.19
281 0.2
282 0.24
283 0.29
284 0.34
285 0.39
286 0.41
287 0.45
288 0.45
289 0.5
290 0.49
291 0.52
292 0.5