Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7T2A0

Protein Details
Accession R7T2A0    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
176-207HTIVTKPSPRRNPKTSRAPRQRRQEQNGPLAPHydrophilic
NLS Segment(s)
PositionSequence
184-197PRRNPKTSRAPRQR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
KEGG dsq:DICSQDRAFT_170126  -  
Amino Acid Sequences MPAPVRQFLKAVEEHEDADSSSDGAFDFADGDNLISLLDAFGINPSRAPSPGAPRKKRMAYSLLQLALAAAWEAYRLDTSDEAEEIMDEDSVGSIFLPVWDQYQDVCKVFWNARTSRTTRPTPEETQCAAPPTVFLPVDTTPDPPVLLAQAGTLRLPLEPAVNTKDMLPPQVPVLHTIVTKPSPRRNPKTSRAPRQRRQEQNGPLAPFRSSGWTRPRTPPLSAPPFFSPSPSICNTPLAAPRQSAGPSCSQWDDFATSSSGFSSARSRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.28
4 0.22
5 0.21
6 0.19
7 0.12
8 0.11
9 0.09
10 0.08
11 0.08
12 0.07
13 0.05
14 0.07
15 0.06
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.07
29 0.09
30 0.09
31 0.1
32 0.12
33 0.13
34 0.14
35 0.17
36 0.19
37 0.27
38 0.37
39 0.47
40 0.52
41 0.57
42 0.65
43 0.69
44 0.68
45 0.63
46 0.6
47 0.52
48 0.52
49 0.52
50 0.44
51 0.37
52 0.33
53 0.28
54 0.21
55 0.17
56 0.11
57 0.04
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.05
64 0.06
65 0.07
66 0.09
67 0.09
68 0.09
69 0.09
70 0.09
71 0.08
72 0.07
73 0.07
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.05
86 0.06
87 0.06
88 0.07
89 0.07
90 0.11
91 0.13
92 0.13
93 0.13
94 0.13
95 0.15
96 0.17
97 0.21
98 0.23
99 0.22
100 0.26
101 0.31
102 0.34
103 0.39
104 0.43
105 0.42
106 0.41
107 0.45
108 0.47
109 0.47
110 0.47
111 0.44
112 0.39
113 0.38
114 0.35
115 0.31
116 0.25
117 0.19
118 0.16
119 0.12
120 0.13
121 0.1
122 0.09
123 0.1
124 0.1
125 0.13
126 0.13
127 0.14
128 0.12
129 0.12
130 0.12
131 0.09
132 0.09
133 0.06
134 0.06
135 0.05
136 0.04
137 0.05
138 0.05
139 0.05
140 0.06
141 0.05
142 0.05
143 0.06
144 0.06
145 0.06
146 0.06
147 0.09
148 0.12
149 0.12
150 0.12
151 0.13
152 0.16
153 0.15
154 0.17
155 0.15
156 0.13
157 0.14
158 0.17
159 0.16
160 0.15
161 0.16
162 0.15
163 0.15
164 0.15
165 0.17
166 0.17
167 0.22
168 0.25
169 0.33
170 0.41
171 0.51
172 0.59
173 0.65
174 0.71
175 0.75
176 0.81
177 0.83
178 0.84
179 0.86
180 0.88
181 0.87
182 0.9
183 0.9
184 0.89
185 0.87
186 0.86
187 0.82
188 0.81
189 0.78
190 0.71
191 0.62
192 0.53
193 0.45
194 0.36
195 0.29
196 0.26
197 0.22
198 0.26
199 0.34
200 0.4
201 0.45
202 0.52
203 0.6
204 0.56
205 0.58
206 0.59
207 0.59
208 0.62
209 0.58
210 0.55
211 0.5
212 0.51
213 0.47
214 0.42
215 0.35
216 0.28
217 0.32
218 0.3
219 0.3
220 0.27
221 0.29
222 0.28
223 0.29
224 0.33
225 0.32
226 0.31
227 0.28
228 0.28
229 0.28
230 0.3
231 0.28
232 0.25
233 0.25
234 0.25
235 0.28
236 0.31
237 0.29
238 0.28
239 0.28
240 0.29
241 0.24
242 0.24
243 0.22
244 0.19
245 0.18
246 0.18
247 0.17
248 0.13
249 0.14