Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CVD9

Protein Details
Accession Q6CVD9   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
124-143TASNTVSGKNGKKKNKKGKKHydrophilic
NLS Segment(s)
PositionSequence
132-143KNGKKKNKKGKK
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039432  SRP9_dom  
KEGG kla:KLLA0_B12782g  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MSVSDLDTFITGSLKLLETNASQTKIMMKYRPQSDDIHSKVTFRTKNDSVGLTYKYKTAHSKELSRGLSAIGPTGVNLQLGKVGKQVFKKKSKDLPGMTTLLVNQKVKPYVEPVKTKVSAPTTTASNTVSGKNGKKKNKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.11
5 0.11
6 0.18
7 0.21
8 0.21
9 0.2
10 0.21
11 0.26
12 0.29
13 0.32
14 0.31
15 0.33
16 0.39
17 0.45
18 0.48
19 0.46
20 0.44
21 0.46
22 0.5
23 0.47
24 0.45
25 0.39
26 0.37
27 0.36
28 0.41
29 0.39
30 0.32
31 0.37
32 0.33
33 0.37
34 0.38
35 0.36
36 0.31
37 0.3
38 0.31
39 0.25
40 0.24
41 0.22
42 0.21
43 0.22
44 0.25
45 0.26
46 0.31
47 0.33
48 0.38
49 0.4
50 0.46
51 0.44
52 0.39
53 0.35
54 0.27
55 0.24
56 0.18
57 0.14
58 0.07
59 0.06
60 0.06
61 0.07
62 0.06
63 0.06
64 0.05
65 0.05
66 0.08
67 0.09
68 0.09
69 0.11
70 0.13
71 0.16
72 0.23
73 0.32
74 0.37
75 0.46
76 0.51
77 0.55
78 0.62
79 0.67
80 0.68
81 0.63
82 0.6
83 0.55
84 0.52
85 0.45
86 0.36
87 0.29
88 0.26
89 0.26
90 0.22
91 0.19
92 0.22
93 0.24
94 0.25
95 0.25
96 0.27
97 0.32
98 0.38
99 0.42
100 0.42
101 0.48
102 0.48
103 0.48
104 0.47
105 0.43
106 0.38
107 0.35
108 0.34
109 0.28
110 0.28
111 0.29
112 0.24
113 0.22
114 0.21
115 0.2
116 0.23
117 0.27
118 0.34
119 0.42
120 0.5
121 0.58
122 0.67
123 0.77