Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SVS9

Protein Details
Accession R7SVS9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
254-278GEERERGRAQKHKPKTQPDEEKEREBasic
NLS Segment(s)
PositionSequence
235-281RDRRSRFGRGAGAAVAAAGGEERERGRAQKHKPKTQPDEEKEREKEK
Subcellular Location(s) plas 21, mito 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG dsq:DICSQDRAFT_108072  -  
Amino Acid Sequences MQRLIDACGDFAHDPSVDAVIATGFATPTNNAKPLPNGLPYPEEWTPPMVSPALARFKISWENFVDTLMREWKTFNLVSALLCTTILTIFQIPEAAGDPLTRWSALLSLVCALISLSFGCVYIVHFGTMRSMDRASRWAEEARKTRAALLWNIWVLLATPAVWLAWSMIAFCVAILSFVWRTGSAADPQGGYAPLSRTQALGVRVAISAVFVFGLVNFWMIITTFSSYSHISVRRDRRSRFGRGAGAAVAAAGGEERERGRAQKHKPKTQPDEEKEREKEKDRNRVSDSMVGLGLTGLGQGSPASAAGVILENVDLEKGEAMYLSGERMGALGKMSPRVSPKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.11
5 0.1
6 0.1
7 0.07
8 0.07
9 0.07
10 0.06
11 0.05
12 0.06
13 0.07
14 0.09
15 0.14
16 0.17
17 0.2
18 0.21
19 0.23
20 0.26
21 0.31
22 0.34
23 0.33
24 0.31
25 0.31
26 0.33
27 0.32
28 0.36
29 0.31
30 0.29
31 0.26
32 0.27
33 0.26
34 0.23
35 0.24
36 0.18
37 0.16
38 0.16
39 0.22
40 0.27
41 0.25
42 0.26
43 0.24
44 0.28
45 0.36
46 0.36
47 0.34
48 0.3
49 0.34
50 0.32
51 0.33
52 0.3
53 0.22
54 0.24
55 0.25
56 0.22
57 0.18
58 0.19
59 0.19
60 0.23
61 0.22
62 0.2
63 0.17
64 0.17
65 0.17
66 0.18
67 0.17
68 0.12
69 0.12
70 0.11
71 0.08
72 0.07
73 0.07
74 0.06
75 0.07
76 0.06
77 0.07
78 0.07
79 0.06
80 0.07
81 0.08
82 0.08
83 0.07
84 0.07
85 0.07
86 0.09
87 0.1
88 0.09
89 0.08
90 0.08
91 0.08
92 0.09
93 0.09
94 0.08
95 0.08
96 0.08
97 0.07
98 0.07
99 0.06
100 0.05
101 0.05
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.06
109 0.08
110 0.08
111 0.08
112 0.08
113 0.08
114 0.1
115 0.11
116 0.11
117 0.1
118 0.1
119 0.11
120 0.12
121 0.15
122 0.16
123 0.16
124 0.17
125 0.2
126 0.23
127 0.3
128 0.34
129 0.36
130 0.37
131 0.36
132 0.35
133 0.33
134 0.32
135 0.27
136 0.23
137 0.21
138 0.18
139 0.18
140 0.16
141 0.13
142 0.11
143 0.09
144 0.07
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.03
151 0.03
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.03
161 0.03
162 0.03
163 0.05
164 0.05
165 0.05
166 0.06
167 0.05
168 0.06
169 0.07
170 0.08
171 0.08
172 0.09
173 0.1
174 0.09
175 0.09
176 0.1
177 0.09
178 0.08
179 0.08
180 0.08
181 0.1
182 0.12
183 0.12
184 0.11
185 0.12
186 0.15
187 0.15
188 0.15
189 0.12
190 0.12
191 0.11
192 0.11
193 0.1
194 0.07
195 0.05
196 0.04
197 0.04
198 0.03
199 0.03
200 0.03
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.05
209 0.05
210 0.06
211 0.07
212 0.07
213 0.1
214 0.1
215 0.11
216 0.15
217 0.19
218 0.21
219 0.3
220 0.39
221 0.47
222 0.54
223 0.55
224 0.61
225 0.63
226 0.68
227 0.66
228 0.62
229 0.57
230 0.51
231 0.5
232 0.4
233 0.33
234 0.25
235 0.18
236 0.12
237 0.06
238 0.05
239 0.03
240 0.03
241 0.03
242 0.04
243 0.05
244 0.08
245 0.09
246 0.12
247 0.19
248 0.28
249 0.38
250 0.47
251 0.57
252 0.65
253 0.73
254 0.81
255 0.84
256 0.86
257 0.87
258 0.83
259 0.84
260 0.8
261 0.8
262 0.75
263 0.72
264 0.67
265 0.63
266 0.66
267 0.64
268 0.69
269 0.66
270 0.69
271 0.68
272 0.67
273 0.64
274 0.6
275 0.52
276 0.43
277 0.37
278 0.28
279 0.22
280 0.17
281 0.13
282 0.07
283 0.06
284 0.03
285 0.03
286 0.03
287 0.03
288 0.04
289 0.04
290 0.04
291 0.04
292 0.04
293 0.04
294 0.05
295 0.06
296 0.06
297 0.06
298 0.06
299 0.06
300 0.06
301 0.06
302 0.06
303 0.05
304 0.06
305 0.06
306 0.06
307 0.06
308 0.06
309 0.08
310 0.08
311 0.08
312 0.08
313 0.08
314 0.08
315 0.08
316 0.09
317 0.08
318 0.08
319 0.11
320 0.13
321 0.19
322 0.2
323 0.24