FuNGI

Q12702

Protein Details

Accession

Q12702

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
88-108	IEEKINKIRWCKRTNRAHFLL	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 16, cyto_nucl 14, cyto 10

Family & Domain DBs

InterPro	View protein in InterPro IPR000009 PP2A_PR55 IPR018067 PP2A_PR55_CS IPR015943 WD40/YVTN_repeat-like_dom_sf IPR001680 WD40_repeat IPR036322 WD40_repeat_dom_sf
Gene Ontology	GO:0005829 C:cytosol GO:0072686 C:mitotic spindle GO:0000159 C:protein phosphatase type 2A complex GO:0072542 F:protein phosphatase activator activity GO:0010972 P:negative regulation of G2/M transition of mitotic cell cycle GO:0010515 P:negative regulation of induction of conjugation with cellular fusion GO:0031030 P:negative regulation of septation initiation signaling
KEGG	spo:SPAC227.07c -
PROSITE	View protein in PROSITE PS01024 PR55_1 PS01025 PR55_2 PS00678 WD_REPEATS_1

Amino Acid Sequences

MDDIEDSLDQWKFAQCFGDKGDVEDITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEYKFFTEFQSHEPEFDYLKSLEIEEKINKIRWCKRTNRAHFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHDMIIAAYPRRVYANAHAYHINSISVNSDAETYISADDLRINLWNLSISDHSFNIVDIKPENMEELTEVITSAEFHPINCNHLMYSSSKGNIKLLDLRQSALCDNPCKLFEDQEDQDSKSFFSEIISSISDVKFSQNGRYILSRDYLTLKIWDVNMEKAPVKTIPLHDVLRSKLCDLYENDCIFDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRGQIVLQADKAAFRARKSAANNVPKLNAVKNNDWRSQPQAAMGSASVGLDPDNLDYNKKILHASWHPFEDSVAIAATNNLFVFSKL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.22
3	0.25
4	0.29
5	0.36
6	0.31
7	0.33
8	0.36
9	0.3
10	0.29
11	0.27
12	0.23
13	0.16
14	0.16
15	0.13
16	0.09
17	0.09
18	0.08
19	0.07
20	0.07
21	0.05
22	0.05
23	0.05
24	0.06
25	0.07
26	0.07
27	0.07
28	0.07
29	0.07
30	0.08
31	0.09
32	0.08
33	0.08
34	0.08
35	0.09
36	0.09
37	0.1
38	0.09
39	0.1
40	0.12
41	0.19
42	0.21
43	0.26
44	0.36
45	0.41
46	0.46
47	0.45
48	0.46
49	0.47
50	0.55
51	0.56
52	0.54
53	0.55
54	0.58
55	0.61
56	0.6
57	0.55
58	0.51
59	0.45
60	0.41
61	0.44
62	0.36
63	0.32
64	0.32
65	0.31
66	0.26
67	0.25
68	0.24
69	0.15
70	0.17
71	0.16
72	0.15
73	0.17
74	0.17
75	0.2
76	0.19
77	0.24
78	0.27
79	0.32
80	0.34
81	0.4
82	0.48
83	0.53
84	0.59
85	0.63
86	0.69
87	0.75
88	0.82
89	0.82
90	0.78
91	0.72
92	0.67
93	0.6
94	0.58
95	0.53
96	0.46
97	0.4
98	0.37
99	0.34
100	0.32
101	0.36
102	0.33
103	0.31
104	0.32
105	0.38
106	0.43
107	0.51
108	0.61
109	0.57
110	0.56
111	0.57
112	0.53
113	0.46
114	0.42
115	0.39
116	0.33
117	0.3
118	0.28
119	0.25
120	0.24
121	0.24
122	0.21
123	0.18
124	0.13
125	0.14
126	0.12
127	0.13
128	0.15
129	0.15
130	0.14
131	0.14
132	0.17
133	0.17
134	0.17
135	0.17
136	0.2
137	0.22
138	0.25
139	0.3
140	0.3
141	0.36
142	0.44
143	0.48
144	0.42
145	0.4
146	0.38
147	0.31
148	0.3
149	0.25
150	0.19
151	0.14
152	0.14
153	0.13
154	0.12
155	0.13
156	0.12
157	0.11
158	0.17
159	0.25
160	0.26
161	0.28
162	0.28
163	0.28
164	0.29
165	0.27
166	0.2
167	0.11
168	0.1
169	0.09
170	0.09
171	0.08
172	0.07
173	0.07
174	0.07
175	0.07
176	0.07
177	0.06
178	0.06
179	0.06
180	0.05
181	0.05
182	0.06
183	0.06
184	0.06
185	0.06
186	0.07
187	0.07
188	0.07
189	0.07
190	0.07
191	0.08
192	0.09
193	0.09
194	0.1
195	0.1
196	0.1
197	0.09
198	0.09
199	0.11
200	0.1
201	0.1
202	0.09
203	0.1
204	0.1
205	0.1
206	0.1
207	0.07
208	0.06
209	0.06
210	0.06
211	0.06
212	0.06
213	0.05
214	0.05
215	0.05
216	0.06
217	0.06
218	0.09
219	0.08
220	0.09
221	0.13
222	0.13
223	0.16
224	0.16
225	0.16
226	0.12
227	0.12
228	0.14
229	0.11
230	0.14
231	0.13
232	0.14
233	0.16
234	0.17
235	0.17
236	0.16
237	0.16
238	0.19
239	0.19
240	0.25
241	0.23
242	0.24
243	0.23
244	0.24
245	0.23
246	0.19
247	0.2
248	0.14
249	0.15
250	0.16
251	0.16
252	0.18
253	0.18
254	0.18
255	0.17
256	0.22
257	0.22
258	0.25
259	0.26
260	0.24
261	0.24
262	0.22
263	0.2
264	0.14
265	0.13
266	0.09
267	0.08
268	0.08
269	0.08
270	0.1
271	0.1
272	0.1
273	0.12
274	0.12
275	0.12
276	0.11
277	0.11
278	0.13
279	0.13
280	0.17
281	0.21
282	0.22
283	0.24
284	0.26
285	0.26
286	0.24
287	0.26
288	0.22
289	0.17
290	0.19
291	0.18
292	0.17
293	0.16
294	0.16
295	0.16
296	0.15
297	0.18
298	0.16
299	0.18
300	0.18
301	0.19
302	0.2
303	0.18
304	0.2
305	0.16
306	0.17
307	0.18
308	0.18
309	0.2
310	0.23
311	0.24
312	0.25
313	0.28
314	0.28
315	0.3
316	0.29
317	0.26
318	0.24
319	0.23
320	0.25
321	0.25
322	0.27
323	0.31
324	0.3
325	0.3
326	0.28
327	0.28
328	0.24
329	0.21
330	0.19
331	0.12
332	0.12
333	0.12
334	0.14
335	0.14
336	0.15
337	0.19
338	0.18
339	0.19
340	0.18
341	0.18
342	0.16
343	0.15
344	0.14
345	0.15
346	0.16
347	0.17
348	0.17
349	0.16
350	0.16
351	0.16
352	0.15
353	0.14
354	0.13
355	0.13
356	0.13
357	0.15
358	0.15
359	0.17
360	0.19
361	0.19
362	0.18
363	0.18
364	0.16
365	0.16
366	0.16
367	0.18
368	0.17
369	0.16
370	0.15
371	0.15
372	0.15
373	0.14
374	0.15
375	0.19
376	0.2
377	0.2
378	0.26
379	0.27
380	0.34
381	0.37
382	0.46
383	0.49
384	0.56
385	0.6
386	0.57
387	0.56
388	0.52
389	0.52
390	0.47
391	0.45
392	0.42
393	0.46
394	0.53
395	0.58
396	0.6
397	0.6
398	0.58
399	0.58
400	0.56
401	0.48
402	0.43
403	0.39
404	0.34
405	0.32
406	0.28
407	0.22
408	0.17
409	0.16
410	0.12
411	0.08
412	0.08
413	0.07
414	0.07
415	0.08
416	0.13
417	0.14
418	0.17
419	0.18
420	0.2
421	0.21
422	0.22
423	0.22
424	0.18
425	0.27
426	0.33
427	0.4
428	0.44
429	0.45
430	0.45
431	0.43
432	0.42
433	0.34
434	0.26
435	0.19
436	0.14
437	0.11
438	0.09
439	0.11
440	0.11
441	0.11
442	0.1
443	0.1

Q12702

3D AlphaFold-predicted Structure Viewer