Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q12702

Protein Details
Accession Q12702    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
88-108IEEKINKIRWCKRTNRAHFLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 14, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000009  PP2A_PR55  
IPR018067  PP2A_PR55_CS  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0072686  C:mitotic spindle  
GO:0000159  C:protein phosphatase type 2A complex  
GO:0072542  F:protein phosphatase activator activity  
GO:0010972  P:negative regulation of G2/M transition of mitotic cell cycle  
GO:0010515  P:negative regulation of induction of conjugation with cellular fusion  
GO:0031030  P:negative regulation of septation initiation signaling  
KEGG spo:SPAC227.07c  -  
PROSITE View protein in PROSITE  
PS01024  PR55_1  
PS01025  PR55_2  
PS00678  WD_REPEATS_1  
Amino Acid Sequences MDDIEDSLDQWKFAQCFGDKGDVEDITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEYKFFTEFQSHEPEFDYLKSLEIEEKINKIRWCKRTNRAHFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHDMIIAAYPRRVYANAHAYHINSISVNSDAETYISADDLRINLWNLSISDHSFNIVDIKPENMEELTEVITSAEFHPINCNHLMYSSSKGNIKLLDLRQSALCDNPCKLFEDQEDQDSKSFFSEIISSISDVKFSQNGRYILSRDYLTLKIWDVNMEKAPVKTIPLHDVLRSKLCDLYENDCIFDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRGQIVLQADKAAFRARKSAANNVPKLNAVKNNDWRSQPQAAMGSASVGLDPDNLDYNKKILHASWHPFEDSVAIAATNNLFVFSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.25
4 0.29
5 0.36
6 0.31
7 0.33
8 0.36
9 0.3
10 0.29
11 0.27
12 0.23
13 0.16
14 0.16
15 0.13
16 0.09
17 0.09
18 0.08
19 0.07
20 0.07
21 0.05
22 0.05
23 0.05
24 0.06
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.08
31 0.09
32 0.08
33 0.08
34 0.08
35 0.09
36 0.09
37 0.1
38 0.09
39 0.1
40 0.12
41 0.19
42 0.21
43 0.26
44 0.36
45 0.41
46 0.46
47 0.45
48 0.46
49 0.47
50 0.55
51 0.56
52 0.54
53 0.55
54 0.58
55 0.61
56 0.6
57 0.55
58 0.51
59 0.45
60 0.41
61 0.44
62 0.36
63 0.32
64 0.32
65 0.31
66 0.26
67 0.25
68 0.24
69 0.15
70 0.17
71 0.16
72 0.15
73 0.17
74 0.17
75 0.2
76 0.19
77 0.24
78 0.27
79 0.32
80 0.34
81 0.4
82 0.48
83 0.53
84 0.59
85 0.63
86 0.69
87 0.75
88 0.82
89 0.82
90 0.78
91 0.72
92 0.67
93 0.6
94 0.58
95 0.53
96 0.46
97 0.4
98 0.37
99 0.34
100 0.32
101 0.36
102 0.33
103 0.31
104 0.32
105 0.38
106 0.43
107 0.51
108 0.61
109 0.57
110 0.56
111 0.57
112 0.53
113 0.46
114 0.42
115 0.39
116 0.33
117 0.3
118 0.28
119 0.25
120 0.24
121 0.24
122 0.21
123 0.18
124 0.13
125 0.14
126 0.12
127 0.13
128 0.15
129 0.15
130 0.14
131 0.14
132 0.17
133 0.17
134 0.17
135 0.17
136 0.2
137 0.22
138 0.25
139 0.3
140 0.3
141 0.36
142 0.44
143 0.48
144 0.42
145 0.4
146 0.38
147 0.31
148 0.3
149 0.25
150 0.19
151 0.14
152 0.14
153 0.13
154 0.12
155 0.13
156 0.12
157 0.11
158 0.17
159 0.25
160 0.26
161 0.28
162 0.28
163 0.28
164 0.29
165 0.27
166 0.2
167 0.11
168 0.1
169 0.09
170 0.09
171 0.08
172 0.07
173 0.07
174 0.07
175 0.07
176 0.07
177 0.06
178 0.06
179 0.06
180 0.05
181 0.05
182 0.06
183 0.06
184 0.06
185 0.06
186 0.07
187 0.07
188 0.07
189 0.07
190 0.07
191 0.08
192 0.09
193 0.09
194 0.1
195 0.1
196 0.1
197 0.09
198 0.09
199 0.11
200 0.1
201 0.1
202 0.09
203 0.1
204 0.1
205 0.1
206 0.1
207 0.07
208 0.06
209 0.06
210 0.06
211 0.06
212 0.06
213 0.05
214 0.05
215 0.05
216 0.06
217 0.06
218 0.09
219 0.08
220 0.09
221 0.13
222 0.13
223 0.16
224 0.16
225 0.16
226 0.12
227 0.12
228 0.14
229 0.11
230 0.14
231 0.13
232 0.14
233 0.16
234 0.17
235 0.17
236 0.16
237 0.16
238 0.19
239 0.19
240 0.25
241 0.23
242 0.24
243 0.23
244 0.24
245 0.23
246 0.19
247 0.2
248 0.14
249 0.15
250 0.16
251 0.16
252 0.18
253 0.18
254 0.18
255 0.17
256 0.22
257 0.22
258 0.25
259 0.26
260 0.24
261 0.24
262 0.22
263 0.2
264 0.14
265 0.13
266 0.09
267 0.08
268 0.08
269 0.08
270 0.1
271 0.1
272 0.1
273 0.12
274 0.12
275 0.12
276 0.11
277 0.11
278 0.13
279 0.13
280 0.17
281 0.21
282 0.22
283 0.24
284 0.26
285 0.26
286 0.24
287 0.26
288 0.22
289 0.17
290 0.19
291 0.18
292 0.17
293 0.16
294 0.16
295 0.16
296 0.15
297 0.18
298 0.16
299 0.18
300 0.18
301 0.19
302 0.2
303 0.18
304 0.2
305 0.16
306 0.17
307 0.18
308 0.18
309 0.2
310 0.23
311 0.24
312 0.25
313 0.28
314 0.28
315 0.3
316 0.29
317 0.26
318 0.24
319 0.23
320 0.25
321 0.25
322 0.27
323 0.31
324 0.3
325 0.3
326 0.28
327 0.28
328 0.24
329 0.21
330 0.19
331 0.12
332 0.12
333 0.12
334 0.14
335 0.14
336 0.15
337 0.19
338 0.18
339 0.19
340 0.18
341 0.18
342 0.16
343 0.15
344 0.14
345 0.15
346 0.16
347 0.17
348 0.17
349 0.16
350 0.16
351 0.16
352 0.15
353 0.14
354 0.13
355 0.13
356 0.13
357 0.15
358 0.15
359 0.17
360 0.19
361 0.19
362 0.18
363 0.18
364 0.16
365 0.16
366 0.16
367 0.18
368 0.17
369 0.16
370 0.15
371 0.15
372 0.15
373 0.14
374 0.15
375 0.19
376 0.2
377 0.2
378 0.26
379 0.27
380 0.34
381 0.37
382 0.46
383 0.49
384 0.56
385 0.6
386 0.57
387 0.56
388 0.52
389 0.52
390 0.47
391 0.45
392 0.42
393 0.46
394 0.53
395 0.58
396 0.6
397 0.6
398 0.58
399 0.58
400 0.56
401 0.48
402 0.43
403 0.39
404 0.34
405 0.32
406 0.28
407 0.22
408 0.17
409 0.16
410 0.12
411 0.08
412 0.08
413 0.07
414 0.07
415 0.08
416 0.13
417 0.14
418 0.17
419 0.18
420 0.2
421 0.21
422 0.22
423 0.22
424 0.18
425 0.27
426 0.33
427 0.4
428 0.44
429 0.45
430 0.45
431 0.43
432 0.42
433 0.34
434 0.26
435 0.19
436 0.14
437 0.11
438 0.09
439 0.11
440 0.11
441 0.11
442 0.1
443 0.1