Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7SKZ9

Protein Details
Accession R7SKZ9    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
64-86GPTSPRFRRIQQRSRWRRCWPVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 9, cyto 3
Family & Domain DBs
KEGG dsq:DICSQDRAFT_141168  -  
Amino Acid Sequences MGPLAPVPHIPYGDGYGVPAPSPYSPSPYLRPRSVTCASRMSRQCDRRTHTHMLLLDPPRSLRGPTSPRFRRIQQRSRWRRCWPVAACVLGVLRFAAGDVDECLSQRACFGAERAVGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.14
5 0.14
6 0.12
7 0.11
8 0.1
9 0.15
10 0.15
11 0.19
12 0.22
13 0.25
14 0.32
15 0.39
16 0.45
17 0.43
18 0.47
19 0.44
20 0.48
21 0.5
22 0.46
23 0.41
24 0.43
25 0.42
26 0.46
27 0.48
28 0.47
29 0.5
30 0.55
31 0.58
32 0.57
33 0.6
34 0.59
35 0.62
36 0.62
37 0.54
38 0.51
39 0.45
40 0.4
41 0.41
42 0.36
43 0.3
44 0.24
45 0.22
46 0.19
47 0.19
48 0.17
49 0.12
50 0.17
51 0.23
52 0.28
53 0.39
54 0.42
55 0.47
56 0.5
57 0.54
58 0.58
59 0.61
60 0.65
61 0.65
62 0.71
63 0.78
64 0.83
65 0.86
66 0.83
67 0.82
68 0.77
69 0.77
70 0.68
71 0.65
72 0.59
73 0.52
74 0.45
75 0.36
76 0.32
77 0.22
78 0.19
79 0.12
80 0.07
81 0.06
82 0.06
83 0.05
84 0.04
85 0.05
86 0.06
87 0.07
88 0.08
89 0.08
90 0.1
91 0.11
92 0.11
93 0.1
94 0.1
95 0.1
96 0.11
97 0.12
98 0.16