Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P40380

Protein Details
Accession P40380   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
210-229YSSPQKSRSNTKDENRHNLLHydrophilic
NLS Segment(s)
PositionSequence
105-108KKRK
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
Gene Ontology GO:0005634  C:nucleus  
GO:0004861  F:cyclin-dependent protein serine/threonine kinase inhibitor activity  
GO:0031568  P:mitotic G1 cell size control checkpoint signaling  
GO:2000134  P:negative regulation of G1/S transition of mitotic cell cycle  
GO:0045930  P:negative regulation of mitotic cell cycle  
GO:1903464  P:negative regulation of mitotic cell cycle DNA replication  
GO:1903467  P:negative regulation of mitotic DNA replication initiation  
GO:0032436  P:positive regulation of proteasomal ubiquitin-dependent protein catabolic process  
KEGG spo:SPBC32F12.09  -  
Amino Acid Sequences MEPSTPPMRGLCTPSTPESPGSFKGVIDASLEGNSSIMIDEIPESDLPAPQVSTFPPTPAKTPKKQLLPNLMLQDRSNSLERCMEEDREHNPFLSSSDNQLLSRKKRKPTPPPSDGLYYVFRGKRIKKSFRPGTDLSTFKPKLLFADSAPSSSSDNPTSSVDLNDYSQIGILPPNLNSIGNKMFSLKSRVPSSSSGSFVAPPPQMRLPAYSSPQKSRSNTKDENRHNLLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.39
4 0.39
5 0.37
6 0.36
7 0.33
8 0.34
9 0.3
10 0.26
11 0.27
12 0.24
13 0.21
14 0.19
15 0.17
16 0.13
17 0.13
18 0.13
19 0.1
20 0.09
21 0.08
22 0.07
23 0.06
24 0.05
25 0.04
26 0.04
27 0.05
28 0.06
29 0.07
30 0.07
31 0.08
32 0.08
33 0.09
34 0.1
35 0.1
36 0.1
37 0.09
38 0.1
39 0.1
40 0.15
41 0.15
42 0.16
43 0.21
44 0.22
45 0.27
46 0.36
47 0.43
48 0.45
49 0.53
50 0.58
51 0.61
52 0.66
53 0.68
54 0.68
55 0.64
56 0.62
57 0.6
58 0.53
59 0.46
60 0.4
61 0.35
62 0.27
63 0.26
64 0.24
65 0.18
66 0.19
67 0.21
68 0.21
69 0.23
70 0.24
71 0.23
72 0.21
73 0.24
74 0.25
75 0.26
76 0.26
77 0.22
78 0.2
79 0.18
80 0.17
81 0.18
82 0.16
83 0.14
84 0.16
85 0.17
86 0.17
87 0.22
88 0.26
89 0.3
90 0.39
91 0.43
92 0.46
93 0.54
94 0.63
95 0.7
96 0.75
97 0.77
98 0.72
99 0.69
100 0.65
101 0.6
102 0.51
103 0.43
104 0.33
105 0.25
106 0.25
107 0.22
108 0.22
109 0.24
110 0.28
111 0.35
112 0.42
113 0.5
114 0.53
115 0.63
116 0.69
117 0.69
118 0.71
119 0.63
120 0.6
121 0.56
122 0.5
123 0.41
124 0.42
125 0.38
126 0.31
127 0.31
128 0.25
129 0.21
130 0.23
131 0.23
132 0.14
133 0.21
134 0.21
135 0.2
136 0.21
137 0.19
138 0.17
139 0.17
140 0.2
141 0.14
142 0.14
143 0.16
144 0.17
145 0.17
146 0.16
147 0.16
148 0.14
149 0.13
150 0.14
151 0.13
152 0.12
153 0.1
154 0.09
155 0.08
156 0.08
157 0.07
158 0.09
159 0.09
160 0.09
161 0.11
162 0.12
163 0.12
164 0.12
165 0.16
166 0.17
167 0.16
168 0.17
169 0.17
170 0.18
171 0.2
172 0.27
173 0.27
174 0.3
175 0.34
176 0.35
177 0.36
178 0.38
179 0.41
180 0.38
181 0.36
182 0.32
183 0.28
184 0.28
185 0.26
186 0.29
187 0.26
188 0.23
189 0.26
190 0.27
191 0.29
192 0.29
193 0.31
194 0.31
195 0.34
196 0.39
197 0.43
198 0.46
199 0.5
200 0.56
201 0.61
202 0.6
203 0.64
204 0.67
205 0.67
206 0.71
207 0.74
208 0.77
209 0.78
210 0.83