Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O74903

Protein Details
Accession O74903   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
164-184DKKPEERRKHFVKYNNIPDKYBasic
NLS Segment(s)
Subcellular Location(s) cyto 10, nucl 9, mito 3, vacu 2, pero 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR018247  EF_Hand_1_Ca_BS  
IPR002048  EF_hand_dom  
IPR040250  Nucleobindin  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005788  C:endoplasmic reticulum lumen  
GO:0005793  C:endoplasmic reticulum-Golgi intermediate compartment  
GO:0005794  C:Golgi apparatus  
GO:0005796  C:Golgi lumen  
GO:0005509  F:calcium ion binding  
KEGG spo:SPCC613.03  -  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
PS50222  EF_HAND_2  
Amino Acid Sequences MKFSTVGFLFSTILFKSAFAGWMDTHMKDEHHIDKYTDESFFRLHDLGKKGYWSDQDILSLYGLFENDEVPFVKKNEVLVDVLKKCDPSGNRRITLDEFLAFRKNGGELTDFGFPGHHGDEEEEFEMHHVEKYHPAGLDEPDENWNHPEDIEHFQKHDEIFHGDKKPEERRKHFVKYNNIPDKYRRVSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.12
4 0.12
5 0.14
6 0.12
7 0.14
8 0.13
9 0.18
10 0.21
11 0.19
12 0.21
13 0.2
14 0.19
15 0.2
16 0.25
17 0.25
18 0.27
19 0.29
20 0.27
21 0.28
22 0.31
23 0.3
24 0.27
25 0.21
26 0.18
27 0.17
28 0.17
29 0.17
30 0.15
31 0.15
32 0.2
33 0.23
34 0.24
35 0.24
36 0.25
37 0.24
38 0.27
39 0.28
40 0.25
41 0.23
42 0.21
43 0.21
44 0.2
45 0.2
46 0.16
47 0.13
48 0.09
49 0.08
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.06
56 0.07
57 0.08
58 0.1
59 0.11
60 0.12
61 0.12
62 0.13
63 0.14
64 0.14
65 0.14
66 0.14
67 0.19
68 0.19
69 0.19
70 0.19
71 0.17
72 0.16
73 0.19
74 0.19
75 0.21
76 0.29
77 0.33
78 0.35
79 0.35
80 0.37
81 0.35
82 0.34
83 0.28
84 0.2
85 0.15
86 0.14
87 0.16
88 0.14
89 0.12
90 0.11
91 0.1
92 0.09
93 0.1
94 0.1
95 0.08
96 0.11
97 0.12
98 0.12
99 0.11
100 0.11
101 0.1
102 0.1
103 0.1
104 0.08
105 0.07
106 0.08
107 0.09
108 0.11
109 0.12
110 0.1
111 0.09
112 0.09
113 0.1
114 0.09
115 0.09
116 0.09
117 0.09
118 0.13
119 0.15
120 0.18
121 0.17
122 0.17
123 0.18
124 0.18
125 0.21
126 0.17
127 0.17
128 0.18
129 0.18
130 0.18
131 0.18
132 0.18
133 0.15
134 0.14
135 0.14
136 0.14
137 0.2
138 0.25
139 0.25
140 0.24
141 0.25
142 0.28
143 0.27
144 0.25
145 0.21
146 0.21
147 0.23
148 0.3
149 0.34
150 0.32
151 0.36
152 0.42
153 0.5
154 0.54
155 0.61
156 0.62
157 0.66
158 0.74
159 0.8
160 0.8
161 0.78
162 0.79
163 0.8
164 0.83
165 0.84
166 0.8
167 0.74
168 0.73
169 0.73