Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7SUM7

Protein Details
Accession R7SUM7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
150-170AGRKRMFKGHKWQRTQQGRERBasic
NLS Segment(s)
PositionSequence
153-154KR
157-158KG
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG dsq:DICSQDRAFT_138211  -  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MASALRLVKQFRVRELAPVLKAADPQLSTTRPKVRNPFLPFKNPDTGRWAPAKYSLRRQAELVKNARASGTLHLLPPGPKLSHKELPAASQTVSQTVAAPANGDAVVEGEILVTDAQLKGQPWWSGQVEWEGEFKEKEVKGADVGNRLYAGRKRMFKGHKWQRTQQGREREQKMLLKDMKARIERFKTTYRRKTPSPISPARPVSYSKLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.48
4 0.41
5 0.4
6 0.38
7 0.32
8 0.33
9 0.28
10 0.25
11 0.19
12 0.2
13 0.23
14 0.25
15 0.27
16 0.33
17 0.41
18 0.43
19 0.5
20 0.56
21 0.59
22 0.65
23 0.7
24 0.73
25 0.7
26 0.74
27 0.71
28 0.67
29 0.69
30 0.61
31 0.54
32 0.52
33 0.49
34 0.43
35 0.44
36 0.39
37 0.31
38 0.38
39 0.43
40 0.4
41 0.47
42 0.52
43 0.52
44 0.53
45 0.54
46 0.55
47 0.54
48 0.58
49 0.52
50 0.48
51 0.44
52 0.43
53 0.41
54 0.32
55 0.25
56 0.19
57 0.19
58 0.15
59 0.15
60 0.15
61 0.17
62 0.16
63 0.17
64 0.17
65 0.14
66 0.15
67 0.19
68 0.25
69 0.29
70 0.3
71 0.32
72 0.3
73 0.32
74 0.32
75 0.28
76 0.22
77 0.19
78 0.18
79 0.14
80 0.14
81 0.12
82 0.1
83 0.1
84 0.1
85 0.07
86 0.07
87 0.06
88 0.06
89 0.06
90 0.05
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.05
105 0.05
106 0.06
107 0.09
108 0.1
109 0.1
110 0.15
111 0.16
112 0.15
113 0.15
114 0.17
115 0.15
116 0.15
117 0.16
118 0.13
119 0.13
120 0.12
121 0.12
122 0.16
123 0.15
124 0.16
125 0.16
126 0.16
127 0.16
128 0.2
129 0.22
130 0.2
131 0.2
132 0.19
133 0.18
134 0.18
135 0.21
136 0.2
137 0.24
138 0.26
139 0.3
140 0.32
141 0.41
142 0.48
143 0.51
144 0.6
145 0.64
146 0.68
147 0.7
148 0.76
149 0.77
150 0.81
151 0.81
152 0.78
153 0.78
154 0.77
155 0.8
156 0.76
157 0.7
158 0.66
159 0.63
160 0.57
161 0.56
162 0.52
163 0.47
164 0.48
165 0.5
166 0.52
167 0.53
168 0.54
169 0.53
170 0.56
171 0.57
172 0.56
173 0.59
174 0.62
175 0.67
176 0.74
177 0.74
178 0.75
179 0.75
180 0.79
181 0.79
182 0.79
183 0.78
184 0.76
185 0.73
186 0.75
187 0.76
188 0.68
189 0.61
190 0.55
191 0.52