Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7SRI7

Protein Details
Accession R7SRI7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
11-35LTTDPYESRCRRRFNRRLSSLRIFVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027806  HARBI1_dom  
Gene Ontology GO:0046872  F:metal ion binding  
KEGG dsq:DICSQDRAFT_66690  -  
Pfam View protein in Pfam  
PF13359  DDE_Tnp_4  
Amino Acid Sequences YSIRPFNDYDLTTDPYESRCRRRFNRRLSSLRIFVEHAFGCLKGRFPILRSMSCHDVDEVYKILESLMVIHNILERFQDDPADIEDFDDEEDEGVAEVRGEAPAHLGGENLDGDLSNDELYATGLLRRKWLLNLMRSEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.33
4 0.35
5 0.4
6 0.44
7 0.53
8 0.61
9 0.72
10 0.78
11 0.8
12 0.85
13 0.85
14 0.85
15 0.84
16 0.82
17 0.76
18 0.67
19 0.58
20 0.49
21 0.4
22 0.37
23 0.28
24 0.22
25 0.17
26 0.16
27 0.16
28 0.14
29 0.15
30 0.12
31 0.15
32 0.14
33 0.15
34 0.24
35 0.26
36 0.28
37 0.3
38 0.33
39 0.34
40 0.34
41 0.33
42 0.24
43 0.21
44 0.19
45 0.17
46 0.13
47 0.09
48 0.08
49 0.08
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.06
67 0.07
68 0.09
69 0.09
70 0.09
71 0.08
72 0.08
73 0.08
74 0.08
75 0.07
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.03
84 0.03
85 0.04
86 0.04
87 0.04
88 0.04
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.08
96 0.08
97 0.07
98 0.06
99 0.05
100 0.06
101 0.07
102 0.07
103 0.06
104 0.06
105 0.06
106 0.06
107 0.07
108 0.07
109 0.06
110 0.1
111 0.14
112 0.15
113 0.19
114 0.21
115 0.22
116 0.25
117 0.33
118 0.37
119 0.4