Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P79015

Protein Details
Accession P79015    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-27AAVNIIKKRTKPFKRHQSDRFKRVGEHydrophilic
NLS Segment(s)
PositionSequence
8-33KKRTKPFKRHQSDRFKRVGESWRKPR
Subcellular Location(s) mito 12.5, mito_nucl 10.5, nucl 7.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0022625  C:cytosolic large ribosomal subunit  
GO:0005634  C:nucleus  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG spo:SPAC3H5.10  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAAVNIIKKRTKPFKRHQSDRFKRVGESWRKPRGIDSCVRRRFRGTISMPKIGYGNNKKTRYCMPNGLKAFLVRNVSDVELLLMHNKTYAAEIAGNVSARKRVEIVEKARALGVKVTNAGAKVRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.85
3 0.91
4 0.91
5 0.92
6 0.92
7 0.9
8 0.86
9 0.77
10 0.68
11 0.64
12 0.64
13 0.63
14 0.63
15 0.65
16 0.66
17 0.66
18 0.64
19 0.64
20 0.6
21 0.54
22 0.52
23 0.52
24 0.53
25 0.61
26 0.64
27 0.59
28 0.56
29 0.54
30 0.49
31 0.49
32 0.45
33 0.46
34 0.48
35 0.52
36 0.48
37 0.45
38 0.42
39 0.34
40 0.36
41 0.33
42 0.38
43 0.42
44 0.46
45 0.46
46 0.48
47 0.54
48 0.49
49 0.46
50 0.46
51 0.4
52 0.45
53 0.46
54 0.45
55 0.38
56 0.34
57 0.31
58 0.25
59 0.23
60 0.14
61 0.14
62 0.14
63 0.14
64 0.13
65 0.12
66 0.09
67 0.07
68 0.07
69 0.08
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.08
76 0.08
77 0.07
78 0.07
79 0.08
80 0.09
81 0.1
82 0.11
83 0.1
84 0.11
85 0.13
86 0.13
87 0.14
88 0.13
89 0.15
90 0.22
91 0.3
92 0.35
93 0.41
94 0.41
95 0.41
96 0.42
97 0.4
98 0.33
99 0.3
100 0.27
101 0.2
102 0.21
103 0.22
104 0.22
105 0.22
106 0.23
107 0.2