Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7T2Z7

Protein Details
Accession R7T2Z7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
145-172FVEDTRTKKKRKLWRRKDQPPFEYPFKEBasic
NLS Segment(s)
PositionSequence
151-161TKKKRKLWRRK
Subcellular Location(s) cyto 16, cyto_nucl 11.333, cyto_mito 9.833, nucl 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009446  Mgm101  
Gene Ontology GO:0000262  C:mitochondrial chromosome  
GO:0003697  F:single-stranded DNA binding  
GO:0006281  P:DNA repair  
GO:0000002  P:mitochondrial genome maintenance  
KEGG dsq:DICSQDRAFT_24744  -  
Pfam View protein in Pfam  
PF06420  Mgm101p  
Amino Acid Sequences DWSKSYFGLSTQPFPKEAAETLLAPVDSMDVEIKPDGLIYLPEIKYRRVLNRAFGPGGWGLAPRSETNVGPRVVSREYALVCLGRLVGIARGEQEYFDPSGIPTATEACKSNALMRCCKDLGIASELWDPRFIREFKAKHCVEVFVEDTRTKKKRKLWRRKDQPPFEYPFKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.29
4 0.27
5 0.24
6 0.21
7 0.19
8 0.19
9 0.2
10 0.18
11 0.15
12 0.14
13 0.1
14 0.08
15 0.08
16 0.08
17 0.06
18 0.08
19 0.08
20 0.08
21 0.07
22 0.07
23 0.07
24 0.06
25 0.06
26 0.07
27 0.14
28 0.15
29 0.19
30 0.21
31 0.22
32 0.26
33 0.3
34 0.34
35 0.34
36 0.36
37 0.38
38 0.43
39 0.46
40 0.43
41 0.38
42 0.34
43 0.27
44 0.25
45 0.19
46 0.13
47 0.09
48 0.09
49 0.11
50 0.08
51 0.11
52 0.13
53 0.13
54 0.16
55 0.21
56 0.2
57 0.19
58 0.19
59 0.19
60 0.18
61 0.18
62 0.15
63 0.12
64 0.12
65 0.13
66 0.13
67 0.1
68 0.09
69 0.08
70 0.08
71 0.05
72 0.05
73 0.04
74 0.05
75 0.05
76 0.06
77 0.06
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.07
86 0.06
87 0.08
88 0.08
89 0.07
90 0.06
91 0.08
92 0.09
93 0.1
94 0.11
95 0.11
96 0.13
97 0.13
98 0.19
99 0.23
100 0.26
101 0.3
102 0.31
103 0.34
104 0.33
105 0.32
106 0.27
107 0.23
108 0.23
109 0.2
110 0.18
111 0.16
112 0.21
113 0.21
114 0.21
115 0.22
116 0.19
117 0.18
118 0.25
119 0.23
120 0.24
121 0.32
122 0.35
123 0.38
124 0.48
125 0.46
126 0.44
127 0.45
128 0.42
129 0.35
130 0.36
131 0.33
132 0.26
133 0.29
134 0.27
135 0.29
136 0.35
137 0.4
138 0.41
139 0.46
140 0.52
141 0.6
142 0.69
143 0.77
144 0.79
145 0.84
146 0.9
147 0.94
148 0.96
149 0.95
150 0.92
151 0.88
152 0.85