Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SLE5

Protein Details
Accession R7SLE5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-23EGKSARLRIKQVRSKIRKADVFHydrophilic
36-60PWSSRRCPQTRPRVRKRTKGGRDEVBasic
NLS Segment(s)
PositionSequence
47-54PRVRKRTK
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 5.5, cyto 1.5
Family & Domain DBs
KEGG dsq:DICSQDRAFT_157859  -  
Amino Acid Sequences MEGKSARLRIKQVRSKIRKADVFIFPPTVTPFRPGPWSSRRCPQTRPRVRKRTKGGRDEVYEGTLNEWMNLLSSRTRYRGSTLTYTARRRDSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.81
4 0.81
5 0.75
6 0.71
7 0.68
8 0.64
9 0.59
10 0.52
11 0.46
12 0.37
13 0.33
14 0.31
15 0.26
16 0.2
17 0.2
18 0.19
19 0.18
20 0.24
21 0.23
22 0.27
23 0.34
24 0.39
25 0.39
26 0.46
27 0.51
28 0.48
29 0.54
30 0.58
31 0.59
32 0.64
33 0.72
34 0.74
35 0.79
36 0.83
37 0.85
38 0.86
39 0.85
40 0.84
41 0.82
42 0.78
43 0.73
44 0.7
45 0.65
46 0.56
47 0.47
48 0.39
49 0.3
50 0.24
51 0.2
52 0.16
53 0.12
54 0.11
55 0.08
56 0.09
57 0.09
58 0.1
59 0.1
60 0.14
61 0.18
62 0.21
63 0.24
64 0.24
65 0.28
66 0.32
67 0.35
68 0.38
69 0.39
70 0.45
71 0.51
72 0.56
73 0.58