Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SUM9

Protein Details
Accession R7SUM9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
114-143DERPMPRGPIFPRRRRRRPRTVDAANPSSTHydrophilic
NLS Segment(s)
PositionSequence
120-133RGPIFPRRRRRRPR
Subcellular Location(s) mito 13, nucl 11, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
KEGG dsq:DICSQDRAFT_64347  -  
Amino Acid Sequences MSESASRFSRRSFLPHSSSSTSSAGGGGGKDKEREKEKEKEKEEAYVPDAKDLIKQYTLQHAESGLASDYVKRKNVIRVRMMGEQFLLQAKDVAAVVDWIEGIQMGTNVALDLDERPMPRGPIFPRRRRRRPRTVDAANPSSTAAAAAES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.52
4 0.51
5 0.5
6 0.47
7 0.41
8 0.34
9 0.28
10 0.24
11 0.18
12 0.14
13 0.13
14 0.12
15 0.13
16 0.14
17 0.18
18 0.2
19 0.26
20 0.32
21 0.39
22 0.42
23 0.49
24 0.57
25 0.63
26 0.64
27 0.65
28 0.6
29 0.58
30 0.54
31 0.48
32 0.41
33 0.37
34 0.33
35 0.27
36 0.26
37 0.21
38 0.22
39 0.2
40 0.19
41 0.15
42 0.16
43 0.16
44 0.24
45 0.26
46 0.23
47 0.22
48 0.2
49 0.19
50 0.17
51 0.17
52 0.08
53 0.07
54 0.06
55 0.08
56 0.11
57 0.13
58 0.15
59 0.15
60 0.17
61 0.25
62 0.3
63 0.34
64 0.34
65 0.35
66 0.38
67 0.42
68 0.41
69 0.33
70 0.28
71 0.22
72 0.19
73 0.16
74 0.12
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.06
81 0.05
82 0.05
83 0.05
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.07
101 0.09
102 0.1
103 0.13
104 0.14
105 0.16
106 0.17
107 0.23
108 0.26
109 0.35
110 0.45
111 0.53
112 0.63
113 0.72
114 0.82
115 0.87
116 0.91
117 0.92
118 0.92
119 0.92
120 0.92
121 0.9
122 0.88
123 0.86
124 0.81
125 0.71
126 0.61
127 0.51
128 0.41
129 0.31
130 0.22