Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9Y812

Protein Details
Accession Q9Y812   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
7-31MAEPGDPIPRPRKKRYRPGTTALREHydrophilic
NLS Segment(s)
PositionSequence
15-24PRPRKKRYRP
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000164  Histone_H3/CENP-A  
Gene Ontology GO:0061638  C:CENP-A containing chromatin  
GO:0043505  C:CENP-A containing nucleosome  
GO:0000785  C:chromatin  
GO:0034506  C:chromosome, centromeric core domain  
GO:0000775  C:chromosome, centromeric region  
GO:0000779  C:condensed chromosome, centromeric region  
GO:0005634  C:nucleus  
GO:0019237  F:centromeric DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
GO:0034080  P:CENP-A containing chromatin assembly  
KEGG spo:SPBC1105.17  -  
Pfam View protein in Pfam  
PF00125  Histone  
Amino Acid Sequences MAKKSLMAEPGDPIPRPRKKRYRPGTTALREIRKYQRSTDLLIQRLPFSRIVREISSEFVANFSTDVGLRWQSTALQCLQEAAEAFLVHLFEDTNLCAIHAKRVTIMQRDMQLARRIRGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.51
4 0.59
5 0.64
6 0.71
7 0.81
8 0.86
9 0.87
10 0.85
11 0.86
12 0.86
13 0.8
14 0.79
15 0.75
16 0.71
17 0.62
18 0.61
19 0.61
20 0.58
21 0.55
22 0.5
23 0.51
24 0.47
25 0.49
26 0.51
27 0.48
28 0.43
29 0.43
30 0.4
31 0.33
32 0.32
33 0.29
34 0.25
35 0.19
36 0.19
37 0.2
38 0.22
39 0.2
40 0.21
41 0.2
42 0.19
43 0.18
44 0.16
45 0.13
46 0.11
47 0.11
48 0.08
49 0.07
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.07
56 0.07
57 0.07
58 0.08
59 0.1
60 0.1
61 0.12
62 0.12
63 0.12
64 0.11
65 0.12
66 0.11
67 0.1
68 0.1
69 0.09
70 0.08
71 0.07
72 0.08
73 0.07
74 0.08
75 0.06
76 0.06
77 0.05
78 0.05
79 0.06
80 0.06
81 0.07
82 0.07
83 0.07
84 0.1
85 0.11
86 0.18
87 0.19
88 0.2
89 0.2
90 0.26
91 0.31
92 0.35
93 0.38
94 0.35
95 0.37
96 0.41
97 0.42
98 0.43
99 0.45
100 0.44