Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SI01

Protein Details
Accession R7SI01    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
175-196FESPILRPRKKRARASVKDTFDHydrophilic
NLS Segment(s)
PositionSequence
179-188ILRPRKKRAR
Subcellular Location(s) nucl 9.5cyto_nucl 9.5, cyto 8.5, cysk 6
Family & Domain DBs
KEGG dsq:DICSQDRAFT_130582  -  
Amino Acid Sequences MMFEEGAPPLPPLMGPPAPPANSPPMAPVIQPLEPRDPPPRRPTPMPLFIGGVGISDPEPPLLPRMRPVPTPAISRLLRSLGTVETPQLKVQEVQGWTAHAESEEEPSPENQEEAASAEDTPMELEYPSSPEPEPEPEPVTDEATKEAPSAEEEAEGPQARYNLRPRPEPRKSYFESPILRPRKKRARASVKDTFDHPKLALQVAERIGLENILLVPARLWTKDERRFMRLVIKSIRRALSGKVGYGEVVPMYGPGAVVGGGSDTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.23
4 0.29
5 0.3
6 0.31
7 0.33
8 0.33
9 0.32
10 0.31
11 0.28
12 0.26
13 0.25
14 0.24
15 0.25
16 0.22
17 0.24
18 0.27
19 0.28
20 0.31
21 0.32
22 0.36
23 0.43
24 0.45
25 0.49
26 0.55
27 0.61
28 0.61
29 0.65
30 0.7
31 0.68
32 0.7
33 0.66
34 0.58
35 0.51
36 0.44
37 0.39
38 0.29
39 0.2
40 0.12
41 0.09
42 0.08
43 0.07
44 0.07
45 0.06
46 0.07
47 0.07
48 0.12
49 0.14
50 0.15
51 0.18
52 0.23
53 0.26
54 0.27
55 0.31
56 0.34
57 0.34
58 0.38
59 0.36
60 0.38
61 0.36
62 0.36
63 0.33
64 0.28
65 0.24
66 0.2
67 0.2
68 0.13
69 0.14
70 0.13
71 0.13
72 0.15
73 0.15
74 0.16
75 0.15
76 0.15
77 0.14
78 0.15
79 0.19
80 0.16
81 0.17
82 0.16
83 0.16
84 0.16
85 0.15
86 0.13
87 0.08
88 0.09
89 0.07
90 0.1
91 0.11
92 0.11
93 0.11
94 0.11
95 0.13
96 0.12
97 0.12
98 0.09
99 0.07
100 0.07
101 0.08
102 0.08
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.04
110 0.04
111 0.03
112 0.04
113 0.04
114 0.07
115 0.08
116 0.09
117 0.09
118 0.1
119 0.11
120 0.14
121 0.16
122 0.14
123 0.16
124 0.14
125 0.17
126 0.17
127 0.18
128 0.15
129 0.14
130 0.13
131 0.13
132 0.13
133 0.1
134 0.1
135 0.07
136 0.08
137 0.09
138 0.08
139 0.08
140 0.08
141 0.08
142 0.1
143 0.1
144 0.1
145 0.09
146 0.1
147 0.11
148 0.15
149 0.2
150 0.25
151 0.28
152 0.36
153 0.42
154 0.51
155 0.59
156 0.63
157 0.62
158 0.63
159 0.64
160 0.63
161 0.62
162 0.58
163 0.54
164 0.51
165 0.55
166 0.57
167 0.59
168 0.57
169 0.62
170 0.65
171 0.71
172 0.75
173 0.76
174 0.78
175 0.81
176 0.84
177 0.84
178 0.78
179 0.7
180 0.64
181 0.59
182 0.5
183 0.43
184 0.35
185 0.28
186 0.25
187 0.24
188 0.22
189 0.17
190 0.2
191 0.19
192 0.2
193 0.17
194 0.16
195 0.15
196 0.13
197 0.12
198 0.08
199 0.07
200 0.06
201 0.06
202 0.05
203 0.05
204 0.08
205 0.1
206 0.1
207 0.12
208 0.19
209 0.29
210 0.37
211 0.47
212 0.49
213 0.53
214 0.54
215 0.54
216 0.56
217 0.51
218 0.5
219 0.51
220 0.53
221 0.54
222 0.59
223 0.58
224 0.51
225 0.49
226 0.45
227 0.45
228 0.4
229 0.36
230 0.31
231 0.29
232 0.27
233 0.25
234 0.23
235 0.13
236 0.11
237 0.09
238 0.07
239 0.07
240 0.07
241 0.06
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05