Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SNV0

Protein Details
Accession R7SNV0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
134-159ADTSAPPSKHRSRRRVKGPRPRPSSMHydrophilic
NLS Segment(s)
PositionSequence
141-156SKHRSRRRVKGPRPRP
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
KEGG dsq:DICSQDRAFT_157179  -  
Amino Acid Sequences MVNSIRRRGSLPAASARAIRKTIGLPRSKSFMWPSHAAPDERQPPSLPSVSRDFTLVSNPSSQDEIEYTPAARPRVRIPRKSSQQPAAIDTDALSAVDECPIQDREPELKPSNDMQNQTQITLAGPVDSSSSPADTSAPPSKHRSRRRVKGPRPRPSSMSATVDGDGRRRYARPARPDNSIPHEIFETRFENPFRPRSWSATLKREKGSASDTSSQASCTSRRLSVFGMLSTFRQSLVKKSDGDESPRDPSPLSLDSSASSTGASVSSASSRSRWSFCMRNGVPRTDPYGPPYFAQPPIPSADADRGRRAAGRIAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.46
4 0.43
5 0.38
6 0.33
7 0.28
8 0.3
9 0.37
10 0.41
11 0.46
12 0.46
13 0.48
14 0.53
15 0.5
16 0.5
17 0.48
18 0.46
19 0.44
20 0.43
21 0.42
22 0.45
23 0.49
24 0.45
25 0.41
26 0.44
27 0.46
28 0.44
29 0.44
30 0.37
31 0.35
32 0.38
33 0.41
34 0.33
35 0.28
36 0.32
37 0.32
38 0.31
39 0.29
40 0.25
41 0.21
42 0.26
43 0.24
44 0.19
45 0.21
46 0.21
47 0.22
48 0.22
49 0.21
50 0.17
51 0.16
52 0.16
53 0.16
54 0.15
55 0.15
56 0.16
57 0.2
58 0.22
59 0.21
60 0.22
61 0.28
62 0.38
63 0.47
64 0.52
65 0.57
66 0.65
67 0.73
68 0.8
69 0.78
70 0.74
71 0.72
72 0.65
73 0.61
74 0.53
75 0.44
76 0.35
77 0.28
78 0.21
79 0.14
80 0.12
81 0.09
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.08
88 0.1
89 0.1
90 0.1
91 0.13
92 0.17
93 0.2
94 0.26
95 0.26
96 0.26
97 0.28
98 0.3
99 0.35
100 0.35
101 0.34
102 0.3
103 0.35
104 0.34
105 0.32
106 0.29
107 0.21
108 0.17
109 0.16
110 0.14
111 0.07
112 0.06
113 0.06
114 0.08
115 0.07
116 0.09
117 0.07
118 0.08
119 0.08
120 0.08
121 0.09
122 0.08
123 0.13
124 0.18
125 0.2
126 0.22
127 0.29
128 0.38
129 0.46
130 0.56
131 0.61
132 0.65
133 0.72
134 0.81
135 0.85
136 0.87
137 0.88
138 0.9
139 0.89
140 0.87
141 0.8
142 0.72
143 0.65
144 0.61
145 0.53
146 0.46
147 0.36
148 0.3
149 0.27
150 0.26
151 0.22
152 0.18
153 0.16
154 0.14
155 0.14
156 0.13
157 0.19
158 0.26
159 0.33
160 0.4
161 0.49
162 0.5
163 0.54
164 0.57
165 0.55
166 0.53
167 0.51
168 0.42
169 0.33
170 0.31
171 0.27
172 0.24
173 0.23
174 0.18
175 0.15
176 0.18
177 0.18
178 0.22
179 0.25
180 0.29
181 0.28
182 0.33
183 0.34
184 0.36
185 0.41
186 0.46
187 0.47
188 0.53
189 0.59
190 0.56
191 0.55
192 0.52
193 0.46
194 0.39
195 0.37
196 0.31
197 0.29
198 0.29
199 0.28
200 0.27
201 0.27
202 0.25
203 0.22
204 0.21
205 0.16
206 0.16
207 0.18
208 0.19
209 0.2
210 0.22
211 0.22
212 0.25
213 0.25
214 0.22
215 0.21
216 0.19
217 0.19
218 0.19
219 0.18
220 0.13
221 0.16
222 0.16
223 0.21
224 0.26
225 0.29
226 0.28
227 0.3
228 0.37
229 0.36
230 0.41
231 0.39
232 0.37
233 0.38
234 0.38
235 0.37
236 0.29
237 0.27
238 0.26
239 0.24
240 0.23
241 0.2
242 0.19
243 0.19
244 0.21
245 0.2
246 0.15
247 0.12
248 0.09
249 0.09
250 0.08
251 0.08
252 0.06
253 0.07
254 0.08
255 0.11
256 0.12
257 0.13
258 0.18
259 0.22
260 0.24
261 0.27
262 0.32
263 0.38
264 0.41
265 0.5
266 0.47
267 0.54
268 0.56
269 0.58
270 0.55
271 0.5
272 0.53
273 0.47
274 0.47
275 0.43
276 0.45
277 0.41
278 0.38
279 0.41
280 0.38
281 0.36
282 0.39
283 0.34
284 0.3
285 0.33
286 0.33
287 0.28
288 0.27
289 0.33
290 0.36
291 0.39
292 0.41
293 0.39
294 0.39
295 0.42
296 0.41