Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SV64

Protein Details
Accession R7SV64    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-33IVDSNRCKPKRCAQECKKYFRGSEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 9.333, cyto_mito 9.166, mito 6.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR003439  ABC_transporter-like_ATP-bd  
IPR027417  P-loop_NTPase  
IPR013283  RLI1  
IPR007209  RNaseL-inhib-like_metal-bd_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016787  F:hydrolase activity  
KEGG dsq:DICSQDRAFT_148314  -  
Pfam View protein in Pfam  
PF00005  ABC_tran  
PF04068  RLI  
Amino Acid Sequences MSDKITRIAIVDSNRCKPKRCAQECKKYFRGSELQNYFTKVLEDNLKALIKPQYVDHIPRAIKGVMTVSQMLDGKLELDNKQKICDDLELNHVLTREINQLSGGELQRFAIAMSCIQRADVYMFDEPSSYLDIRQRLKAAEVIRELLTSNNYVIAVEHDLSVLDYLSDFVCCLYGKPSMYGVVTMPYSVREGINIFLDGFIPTENLRFREESLSFKMVETAEELIVDVTRHYSYPAMTKTLGGFKLTVEGGTFTDSEIIVMLGENGTGKTTFVKLLAGDAPDDPNTERPTLAVSLKPQAISPTFAGTVRMLLLKRIKSMFMHPQFNTDVIKPMNLEPILDQEVKTLSGGELQRVAIVLALGKPGVSVYLIDEPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.6
4 0.63
5 0.66
6 0.68
7 0.72
8 0.74
9 0.76
10 0.84
11 0.87
12 0.89
13 0.87
14 0.82
15 0.74
16 0.7
17 0.68
18 0.63
19 0.65
20 0.61
21 0.57
22 0.53
23 0.56
24 0.49
25 0.4
26 0.35
27 0.25
28 0.24
29 0.26
30 0.25
31 0.22
32 0.26
33 0.27
34 0.25
35 0.28
36 0.3
37 0.25
38 0.24
39 0.24
40 0.27
41 0.3
42 0.35
43 0.35
44 0.37
45 0.36
46 0.36
47 0.38
48 0.31
49 0.27
50 0.24
51 0.23
52 0.18
53 0.2
54 0.19
55 0.16
56 0.18
57 0.19
58 0.18
59 0.15
60 0.12
61 0.11
62 0.12
63 0.15
64 0.14
65 0.21
66 0.27
67 0.27
68 0.3
69 0.3
70 0.29
71 0.28
72 0.3
73 0.25
74 0.21
75 0.26
76 0.26
77 0.25
78 0.26
79 0.23
80 0.19
81 0.17
82 0.17
83 0.17
84 0.15
85 0.15
86 0.13
87 0.13
88 0.15
89 0.19
90 0.18
91 0.13
92 0.13
93 0.13
94 0.13
95 0.13
96 0.11
97 0.08
98 0.07
99 0.09
100 0.11
101 0.12
102 0.12
103 0.12
104 0.12
105 0.11
106 0.12
107 0.11
108 0.11
109 0.12
110 0.12
111 0.12
112 0.12
113 0.12
114 0.11
115 0.13
116 0.1
117 0.11
118 0.14
119 0.2
120 0.22
121 0.24
122 0.25
123 0.22
124 0.23
125 0.26
126 0.24
127 0.24
128 0.22
129 0.22
130 0.21
131 0.2
132 0.19
133 0.16
134 0.15
135 0.11
136 0.1
137 0.08
138 0.08
139 0.07
140 0.07
141 0.08
142 0.08
143 0.08
144 0.08
145 0.07
146 0.07
147 0.07
148 0.07
149 0.05
150 0.04
151 0.03
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.05
159 0.05
160 0.06
161 0.09
162 0.09
163 0.1
164 0.11
165 0.11
166 0.11
167 0.12
168 0.1
169 0.09
170 0.08
171 0.07
172 0.07
173 0.06
174 0.07
175 0.07
176 0.07
177 0.06
178 0.07
179 0.07
180 0.08
181 0.08
182 0.07
183 0.06
184 0.07
185 0.06
186 0.06
187 0.05
188 0.05
189 0.05
190 0.07
191 0.09
192 0.1
193 0.12
194 0.12
195 0.13
196 0.18
197 0.19
198 0.21
199 0.24
200 0.24
201 0.22
202 0.22
203 0.23
204 0.18
205 0.17
206 0.14
207 0.11
208 0.09
209 0.09
210 0.09
211 0.06
212 0.07
213 0.06
214 0.05
215 0.05
216 0.06
217 0.06
218 0.07
219 0.07
220 0.08
221 0.14
222 0.15
223 0.16
224 0.16
225 0.17
226 0.18
227 0.22
228 0.22
229 0.18
230 0.16
231 0.14
232 0.16
233 0.15
234 0.14
235 0.09
236 0.09
237 0.09
238 0.1
239 0.1
240 0.07
241 0.08
242 0.08
243 0.08
244 0.07
245 0.06
246 0.04
247 0.04
248 0.05
249 0.03
250 0.04
251 0.04
252 0.04
253 0.05
254 0.05
255 0.05
256 0.07
257 0.08
258 0.09
259 0.09
260 0.1
261 0.09
262 0.12
263 0.14
264 0.13
265 0.13
266 0.13
267 0.14
268 0.13
269 0.15
270 0.14
271 0.16
272 0.18
273 0.18
274 0.17
275 0.16
276 0.18
277 0.2
278 0.21
279 0.19
280 0.19
281 0.24
282 0.25
283 0.25
284 0.23
285 0.24
286 0.23
287 0.24
288 0.22
289 0.2
290 0.19
291 0.19
292 0.21
293 0.17
294 0.16
295 0.14
296 0.17
297 0.14
298 0.18
299 0.24
300 0.25
301 0.29
302 0.3
303 0.31
304 0.3
305 0.37
306 0.42
307 0.43
308 0.49
309 0.45
310 0.48
311 0.47
312 0.47
313 0.43
314 0.33
315 0.31
316 0.24
317 0.26
318 0.23
319 0.23
320 0.28
321 0.25
322 0.24
323 0.19
324 0.24
325 0.27
326 0.26
327 0.24
328 0.19
329 0.2
330 0.2
331 0.2
332 0.15
333 0.1
334 0.16
335 0.17
336 0.18
337 0.19
338 0.18
339 0.18
340 0.18
341 0.17
342 0.11
343 0.11
344 0.1
345 0.08
346 0.09
347 0.09
348 0.08
349 0.08
350 0.08
351 0.08
352 0.07
353 0.07
354 0.1
355 0.17