Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SLP7

Protein Details
Accession R7SLP7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
2-21GRSAKFYKRTDKKKTSSAGSHydrophilic
NLS Segment(s)
PositionSequence
13-62KKKTSSAGSAPRSAVQSAPKPKTAVSAPTPKEQKKRTGLKEKAKAHKSKR
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
KEGG dsq:DICSQDRAFT_174693  -  
Amino Acid Sequences MGRSAKFYKRTDKKKTSSAGSAPRSAVQSAPKPKTAVSAPTPKEQKKRTGLKEKAKAHKSKREGDIPVLGGADYVELMLGGRRKAAAEAAKLPKDPDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.75
4 0.72
5 0.69
6 0.68
7 0.62
8 0.59
9 0.51
10 0.47
11 0.42
12 0.36
13 0.3
14 0.26
15 0.3
16 0.35
17 0.37
18 0.38
19 0.37
20 0.36
21 0.38
22 0.34
23 0.31
24 0.28
25 0.34
26 0.34
27 0.4
28 0.46
29 0.47
30 0.53
31 0.51
32 0.54
33 0.53
34 0.6
35 0.62
36 0.67
37 0.71
38 0.73
39 0.78
40 0.79
41 0.79
42 0.78
43 0.77
44 0.74
45 0.74
46 0.71
47 0.69
48 0.67
49 0.64
50 0.59
51 0.54
52 0.5
53 0.42
54 0.36
55 0.28
56 0.22
57 0.15
58 0.12
59 0.09
60 0.05
61 0.04
62 0.03
63 0.03
64 0.03
65 0.06
66 0.08
67 0.08
68 0.09
69 0.1
70 0.1
71 0.12
72 0.17
73 0.2
74 0.22
75 0.31
76 0.39
77 0.42
78 0.42