Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TG21

Protein Details
Accession A7TG21   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
129-154QLFKESKNSQSNKNKKNKHKKQKKRNHydrophilic
NLS Segment(s)
PositionSequence
140-154NKNKKNKHKKQKKRN
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
KEGG vpo:Kpol_1028p53  -  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSEITGKLSNRVMNMKFMKFSKSSTDETESEVVSTAKKFSDSSEWTLPKHKGTDDDQVQKSSVRKVIRVRRTPIVLSNVGVATIKEDVNIIRGRRMVGEPPQEHVKRSSETAEISSEKEDDGYEPCLDQLFKESKNSQSNKNKKNKHKKQKKRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.42
4 0.41
5 0.42
6 0.37
7 0.38
8 0.37
9 0.36
10 0.37
11 0.38
12 0.42
13 0.37
14 0.4
15 0.39
16 0.3
17 0.25
18 0.23
19 0.18
20 0.14
21 0.14
22 0.11
23 0.1
24 0.11
25 0.11
26 0.12
27 0.2
28 0.22
29 0.28
30 0.35
31 0.36
32 0.37
33 0.43
34 0.42
35 0.37
36 0.35
37 0.3
38 0.26
39 0.28
40 0.36
41 0.37
42 0.44
43 0.42
44 0.41
45 0.41
46 0.39
47 0.36
48 0.3
49 0.29
50 0.22
51 0.24
52 0.32
53 0.41
54 0.49
55 0.54
56 0.55
57 0.54
58 0.55
59 0.52
60 0.47
61 0.42
62 0.33
63 0.26
64 0.23
65 0.18
66 0.15
67 0.14
68 0.1
69 0.06
70 0.07
71 0.06
72 0.05
73 0.06
74 0.06
75 0.09
76 0.13
77 0.12
78 0.13
79 0.14
80 0.14
81 0.16
82 0.17
83 0.17
84 0.21
85 0.29
86 0.28
87 0.31
88 0.39
89 0.38
90 0.38
91 0.37
92 0.34
93 0.27
94 0.29
95 0.28
96 0.21
97 0.22
98 0.22
99 0.23
100 0.2
101 0.2
102 0.19
103 0.17
104 0.14
105 0.14
106 0.12
107 0.1
108 0.11
109 0.13
110 0.12
111 0.12
112 0.12
113 0.14
114 0.13
115 0.12
116 0.16
117 0.18
118 0.2
119 0.26
120 0.29
121 0.36
122 0.46
123 0.49
124 0.53
125 0.59
126 0.69
127 0.72
128 0.8
129 0.82
130 0.84
131 0.92
132 0.93
133 0.93
134 0.94