Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SMD8

Protein Details
Accession R7SMD8    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
324-346VYTWRPSKCPDAHRENWREKRDAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 10.5, nucl 7.5, cysk 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG dsq:DICSQDRAFT_174059  -  
Pfam View protein in Pfam  
PF08284  RVP_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MGDALALEVRHILEEYHPWPEDPLNAFYPPRHMVVQYYDDVTVRDMYLERTLSIPVKFLLNPRFDLLGYFARHVRRLFAAPAFELDDLEGEFRVLFTRKPSPRISPPIPLFAVRPKTRHAESDNSLSALQRNAAAPRDFSRLIPEPVVVVVQVNEQPARALVDSGSLSDFMSARLAHQLGLEVFELTKPLPVQLAVQGSRAKINFGCRVRLEYQRIRTERYFDVINLLNYDLILGTPFIFQHKVTLGLNPTTLVVGSPQALPIEGRQVRTLQSHAADVLDDVLEAARKELREYAAPICKEASDSPLPPLRTINHRIPLIDPDKVYTWRPSKCPDAHRENWREKRDAYLKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.24
4 0.24
5 0.24
6 0.26
7 0.26
8 0.3
9 0.28
10 0.3
11 0.27
12 0.29
13 0.3
14 0.29
15 0.34
16 0.31
17 0.3
18 0.27
19 0.25
20 0.25
21 0.29
22 0.33
23 0.29
24 0.28
25 0.26
26 0.25
27 0.24
28 0.23
29 0.18
30 0.13
31 0.13
32 0.12
33 0.13
34 0.17
35 0.17
36 0.16
37 0.15
38 0.18
39 0.2
40 0.2
41 0.19
42 0.15
43 0.18
44 0.19
45 0.24
46 0.29
47 0.29
48 0.3
49 0.31
50 0.32
51 0.29
52 0.28
53 0.25
54 0.25
55 0.23
56 0.23
57 0.25
58 0.26
59 0.3
60 0.29
61 0.28
62 0.25
63 0.26
64 0.28
65 0.27
66 0.27
67 0.23
68 0.24
69 0.24
70 0.2
71 0.17
72 0.14
73 0.11
74 0.09
75 0.09
76 0.07
77 0.05
78 0.05
79 0.05
80 0.07
81 0.08
82 0.09
83 0.13
84 0.23
85 0.26
86 0.32
87 0.37
88 0.42
89 0.49
90 0.57
91 0.56
92 0.56
93 0.54
94 0.54
95 0.51
96 0.45
97 0.38
98 0.36
99 0.41
100 0.35
101 0.35
102 0.33
103 0.37
104 0.38
105 0.41
106 0.39
107 0.37
108 0.37
109 0.42
110 0.39
111 0.35
112 0.33
113 0.28
114 0.25
115 0.18
116 0.15
117 0.1
118 0.1
119 0.11
120 0.15
121 0.15
122 0.15
123 0.17
124 0.22
125 0.21
126 0.2
127 0.24
128 0.24
129 0.25
130 0.24
131 0.21
132 0.16
133 0.16
134 0.16
135 0.1
136 0.06
137 0.05
138 0.06
139 0.07
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.08
146 0.07
147 0.06
148 0.05
149 0.07
150 0.07
151 0.08
152 0.08
153 0.07
154 0.06
155 0.07
156 0.07
157 0.05
158 0.06
159 0.06
160 0.06
161 0.08
162 0.08
163 0.08
164 0.08
165 0.08
166 0.07
167 0.08
168 0.08
169 0.06
170 0.06
171 0.06
172 0.06
173 0.05
174 0.07
175 0.05
176 0.05
177 0.06
178 0.06
179 0.07
180 0.09
181 0.13
182 0.12
183 0.15
184 0.16
185 0.16
186 0.19
187 0.18
188 0.17
189 0.14
190 0.19
191 0.24
192 0.24
193 0.28
194 0.26
195 0.31
196 0.33
197 0.38
198 0.41
199 0.4
200 0.46
201 0.51
202 0.52
203 0.52
204 0.5
205 0.48
206 0.41
207 0.37
208 0.31
209 0.22
210 0.24
211 0.21
212 0.2
213 0.17
214 0.16
215 0.13
216 0.11
217 0.11
218 0.07
219 0.05
220 0.05
221 0.04
222 0.04
223 0.05
224 0.05
225 0.07
226 0.08
227 0.08
228 0.11
229 0.11
230 0.13
231 0.13
232 0.17
233 0.18
234 0.17
235 0.18
236 0.16
237 0.15
238 0.12
239 0.12
240 0.08
241 0.06
242 0.06
243 0.07
244 0.07
245 0.08
246 0.08
247 0.08
248 0.08
249 0.08
250 0.17
251 0.18
252 0.2
253 0.2
254 0.22
255 0.24
256 0.26
257 0.27
258 0.21
259 0.2
260 0.19
261 0.18
262 0.17
263 0.15
264 0.13
265 0.12
266 0.08
267 0.06
268 0.05
269 0.05
270 0.06
271 0.06
272 0.08
273 0.09
274 0.09
275 0.11
276 0.15
277 0.17
278 0.19
279 0.22
280 0.28
281 0.34
282 0.34
283 0.34
284 0.31
285 0.29
286 0.28
287 0.26
288 0.25
289 0.23
290 0.23
291 0.28
292 0.33
293 0.34
294 0.32
295 0.35
296 0.33
297 0.36
298 0.41
299 0.44
300 0.45
301 0.46
302 0.46
303 0.45
304 0.5
305 0.46
306 0.44
307 0.36
308 0.31
309 0.34
310 0.36
311 0.37
312 0.36
313 0.4
314 0.42
315 0.47
316 0.49
317 0.55
318 0.6
319 0.66
320 0.67
321 0.69
322 0.72
323 0.78
324 0.82
325 0.83
326 0.85
327 0.82
328 0.78
329 0.69
330 0.71
331 0.68