Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SHD4

Protein Details
Accession R7SHD4   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
63-89DAPPTARPSPRVKRKKSRTPSVRDADVHydrophilic
NLS Segment(s)
PositionSequence
69-80RPSPRVKRKKSR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
KEGG dsq:DICSQDRAFT_73438  -  
Amino Acid Sequences QKACKNKFNSEDTKNPARITLCLNNRKPYDIATLTRMTGKDFSGPTPEIRAPTPIRSTELEADAPPTARPSPRVKRKKSRTPSVRDADVEILGDIDDVEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.58
3 0.53
4 0.45
5 0.4
6 0.38
7 0.4
8 0.41
9 0.48
10 0.52
11 0.56
12 0.55
13 0.56
14 0.5
15 0.43
16 0.41
17 0.35
18 0.32
19 0.29
20 0.29
21 0.27
22 0.29
23 0.26
24 0.21
25 0.18
26 0.17
27 0.16
28 0.15
29 0.16
30 0.17
31 0.18
32 0.17
33 0.19
34 0.19
35 0.17
36 0.17
37 0.2
38 0.18
39 0.2
40 0.22
41 0.19
42 0.21
43 0.21
44 0.23
45 0.21
46 0.21
47 0.19
48 0.16
49 0.17
50 0.15
51 0.14
52 0.11
53 0.12
54 0.12
55 0.12
56 0.17
57 0.25
58 0.35
59 0.45
60 0.56
61 0.64
62 0.73
63 0.82
64 0.89
65 0.9
66 0.91
67 0.9
68 0.89
69 0.89
70 0.85
71 0.79
72 0.7
73 0.63
74 0.54
75 0.44
76 0.36
77 0.25
78 0.18
79 0.13
80 0.11