Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2EXB0

Protein Details
Accession A0A0G2EXB0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
110-175KDQPAEKKSRGRPRKPEQPTNGTSASEQKEKKPRGRPKKGEGVTKAKKEKKPSKPRDTKGVSARTRBasic
NLS Segment(s)
PositionSequence
75-178KKGGGKGKSASPAPPPSKKENGENTKKRPHQDSKDKDQPAEKKSRGRPRKPEQPTNGTSASEQKEKKPRGRPKKGEGVTKAKKEKKPSKPRDTKGVSARTRSRA
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR021331  Hva1_TUDOR  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MAGENIEKGDKVSWNWGSGHPGGEVAEKKTQGEVSIKSHRGNTIKKIAEPDNPAVHIARSGNDVVKKASELHVDKKGGGKGKSASPAPPPSKKENGENTKKRPHQDSKDKDQPAEKKSRGRPRKPEQPTNGTSASEQKEKKPRGRPKKGEGVTKAKKEKKPSKPRDTKGVSARTRSRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.3
4 0.33
5 0.31
6 0.3
7 0.22
8 0.21
9 0.19
10 0.22
11 0.22
12 0.2
13 0.24
14 0.23
15 0.23
16 0.24
17 0.24
18 0.22
19 0.24
20 0.24
21 0.26
22 0.35
23 0.37
24 0.37
25 0.38
26 0.41
27 0.44
28 0.45
29 0.45
30 0.45
31 0.45
32 0.45
33 0.49
34 0.46
35 0.46
36 0.45
37 0.43
38 0.36
39 0.34
40 0.33
41 0.28
42 0.25
43 0.21
44 0.16
45 0.12
46 0.12
47 0.12
48 0.14
49 0.15
50 0.16
51 0.15
52 0.15
53 0.15
54 0.14
55 0.15
56 0.19
57 0.2
58 0.23
59 0.29
60 0.29
61 0.29
62 0.31
63 0.32
64 0.31
65 0.29
66 0.27
67 0.23
68 0.25
69 0.28
70 0.26
71 0.24
72 0.24
73 0.31
74 0.33
75 0.37
76 0.38
77 0.4
78 0.45
79 0.45
80 0.47
81 0.49
82 0.54
83 0.59
84 0.62
85 0.64
86 0.67
87 0.69
88 0.66
89 0.65
90 0.64
91 0.64
92 0.68
93 0.69
94 0.69
95 0.74
96 0.72
97 0.66
98 0.64
99 0.6
100 0.56
101 0.57
102 0.52
103 0.51
104 0.59
105 0.68
106 0.71
107 0.74
108 0.78
109 0.78
110 0.85
111 0.85
112 0.86
113 0.83
114 0.81
115 0.74
116 0.69
117 0.61
118 0.51
119 0.43
120 0.4
121 0.36
122 0.34
123 0.33
124 0.36
125 0.44
126 0.51
127 0.59
128 0.62
129 0.7
130 0.74
131 0.83
132 0.85
133 0.84
134 0.88
135 0.85
136 0.84
137 0.81
138 0.8
139 0.78
140 0.78
141 0.79
142 0.77
143 0.77
144 0.79
145 0.81
146 0.82
147 0.84
148 0.86
149 0.87
150 0.89
151 0.89
152 0.89
153 0.86
154 0.84
155 0.82
156 0.81
157 0.76
158 0.74