Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2E600

Protein Details
Accession A0A0G2E600   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-39KIPWRLSAPQKARQRKRLRAVDQVVHydrophilic
73-102DKYTIFDRKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
81-94KEKKYRKGIHKLPK
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTAALSGGLLWKIPWRLSAPQKARQRKRLRAVDQVVDALSTALKNKGHSAKAIERWYQEMPREEEMLPKDKYTIFDRKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.17
4 0.16
5 0.19
6 0.27
7 0.35
8 0.45
9 0.48
10 0.54
11 0.64
12 0.72
13 0.77
14 0.8
15 0.82
16 0.81
17 0.85
18 0.86
19 0.82
20 0.81
21 0.77
22 0.7
23 0.61
24 0.52
25 0.41
26 0.31
27 0.25
28 0.15
29 0.1
30 0.06
31 0.06
32 0.07
33 0.08
34 0.09
35 0.13
36 0.18
37 0.19
38 0.2
39 0.24
40 0.26
41 0.32
42 0.36
43 0.33
44 0.3
45 0.32
46 0.33
47 0.31
48 0.29
49 0.27
50 0.27
51 0.26
52 0.28
53 0.25
54 0.27
55 0.27
56 0.29
57 0.26
58 0.23
59 0.22
60 0.21
61 0.24
62 0.26
63 0.32
64 0.3
65 0.39
66 0.45
67 0.53
68 0.63
69 0.68
70 0.71
71 0.72
72 0.79
73 0.8
74 0.85
75 0.85
76 0.86
77 0.86
78 0.89
79 0.88
80 0.88
81 0.83
82 0.8
83 0.8
84 0.8
85 0.8
86 0.77
87 0.79