Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q92366

Protein Details
Accession Q92366    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAKSKNHTNHNQNKKAHRNGIKRPQKHRYDSHydrophilic
NLS Segment(s)
PositionSequence
14-28KKAHRNGIKRPQKHR
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:0005829  C:cytosol  
GO:0022625  C:cytosolic large ribosomal subunit  
GO:0005730  C:nucleolus  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG spo:SPBC776.01  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKRPQKHRYDSLKYRDAKFRRNQKFANRGTVEAIRQAKASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.8
7 0.84
8 0.84
9 0.82
10 0.82
11 0.82
12 0.81
13 0.77
14 0.76
15 0.75
16 0.74
17 0.74
18 0.72
19 0.7
20 0.65
21 0.63
22 0.63
23 0.58
24 0.58
25 0.58
26 0.62
27 0.64
28 0.68
29 0.71
30 0.72
31 0.78
32 0.73
33 0.75
34 0.66
35 0.58
36 0.55
37 0.52
38 0.43
39 0.41
40 0.4
41 0.3