Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CNI0

Protein Details
Accession Q6CNI0    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
86-116STSGWRDARHHNYKKARLQKNKNKKGSFTKFHydrophilic
NLS Segment(s)
PositionSequence
98-111YKKARLQKNKNKKG
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG kla:KLLA0_E12431g  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSIRASSHLNAKAIKRKGVFQKTVDARAARVAEKLKNDLLKQKLDDLKAKNNGMEVDEETLLQQERLQKEEKLESGEDSEKKVSTSGWRDARHHNYKKARLQKNKNKKGSFTKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.54
4 0.46
5 0.49
6 0.57
7 0.62
8 0.61
9 0.54
10 0.6
11 0.58
12 0.61
13 0.57
14 0.47
15 0.38
16 0.37
17 0.36
18 0.27
19 0.26
20 0.24
21 0.24
22 0.26
23 0.28
24 0.26
25 0.28
26 0.29
27 0.33
28 0.33
29 0.33
30 0.32
31 0.35
32 0.36
33 0.35
34 0.4
35 0.36
36 0.4
37 0.42
38 0.42
39 0.35
40 0.32
41 0.29
42 0.24
43 0.21
44 0.14
45 0.11
46 0.1
47 0.1
48 0.08
49 0.09
50 0.08
51 0.07
52 0.08
53 0.11
54 0.12
55 0.14
56 0.16
57 0.17
58 0.2
59 0.23
60 0.23
61 0.21
62 0.21
63 0.19
64 0.21
65 0.25
66 0.23
67 0.22
68 0.22
69 0.19
70 0.19
71 0.18
72 0.16
73 0.19
74 0.24
75 0.3
76 0.37
77 0.4
78 0.44
79 0.53
80 0.62
81 0.65
82 0.67
83 0.68
84 0.7
85 0.76
86 0.82
87 0.83
88 0.84
89 0.84
90 0.88
91 0.89
92 0.91
93 0.92
94 0.93
95 0.88
96 0.86