Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2H378

Protein Details
Accession A0A0G2H378    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
139-158QRLEQLKKRQRRPIEETINEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 7, extr 5, mito 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039205  NDUFA11  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
Amino Acid Sequences MSSDDNYEPQDAIAKTIPATLIAGTAGLLASAVKNTLTKENVGPMGVFTRTGGTIAVFAGAAAAYQFTATASANLREKNDYINEAIGGFFGGALTGLRARSMPSVLGYGAAFAVCLGAFNYTGGLISGAKPADDIPEYQRLEQLKKRQRRPIEETINEIGEGRGIYGPGYAERRKERLKEAYGIEVPSTPWYKSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.2
4 0.19
5 0.14
6 0.14
7 0.11
8 0.09
9 0.08
10 0.08
11 0.06
12 0.06
13 0.05
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.05
20 0.05
21 0.07
22 0.09
23 0.14
24 0.15
25 0.17
26 0.18
27 0.22
28 0.23
29 0.22
30 0.2
31 0.16
32 0.17
33 0.15
34 0.14
35 0.1
36 0.1
37 0.1
38 0.1
39 0.09
40 0.07
41 0.07
42 0.07
43 0.07
44 0.05
45 0.05
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.02
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.06
58 0.08
59 0.1
60 0.13
61 0.14
62 0.16
63 0.16
64 0.17
65 0.18
66 0.18
67 0.17
68 0.15
69 0.14
70 0.13
71 0.12
72 0.11
73 0.08
74 0.06
75 0.04
76 0.03
77 0.03
78 0.02
79 0.02
80 0.02
81 0.03
82 0.03
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.07
89 0.07
90 0.06
91 0.07
92 0.07
93 0.08
94 0.07
95 0.06
96 0.06
97 0.05
98 0.04
99 0.03
100 0.04
101 0.03
102 0.03
103 0.03
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.04
113 0.05
114 0.07
115 0.07
116 0.07
117 0.07
118 0.08
119 0.09
120 0.1
121 0.11
122 0.12
123 0.2
124 0.22
125 0.22
126 0.25
127 0.25
128 0.3
129 0.35
130 0.43
131 0.44
132 0.53
133 0.61
134 0.67
135 0.74
136 0.78
137 0.8
138 0.8
139 0.8
140 0.73
141 0.71
142 0.64
143 0.56
144 0.47
145 0.38
146 0.27
147 0.18
148 0.15
149 0.11
150 0.08
151 0.07
152 0.07
153 0.08
154 0.09
155 0.11
156 0.18
157 0.19
158 0.26
159 0.31
160 0.39
161 0.45
162 0.49
163 0.54
164 0.57
165 0.6
166 0.6
167 0.57
168 0.58
169 0.54
170 0.5
171 0.43
172 0.34
173 0.3
174 0.29
175 0.28
176 0.21