Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q9Y8G3

Protein Details
Accession Q9Y8G3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-41DTPLEKRRTPGKPRATREPPISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 11.5, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001611  Leu-rich_rpt  
IPR032675  LRR_dom_sf  
IPR040736  Mex67_RRM  
IPR032710  NTF2-like_dom_sf  
IPR018222  Nuclear_transport_factor_2_euk  
IPR030217  NXF_fam  
IPR005637  TAP_C_dom  
IPR009060  UBA-like_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0072686  C:mitotic spindle  
GO:0005643  C:nuclear pore  
GO:0042272  C:nuclear RNA export factor complex  
GO:0140602  C:nucleolar ring  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0016973  P:poly(A)+ mRNA export from nucleus  
GO:0000055  P:ribosomal large subunit export from nucleus  
GO:0006409  P:tRNA export from nucleus  
KEGG spo:SPBC1921.03c  -  
Pfam View protein in Pfam  
PF14580  LRR_9  
PF18444  RRM_9  
PF03943  TAP_C  
PROSITE View protein in PROSITE  
PS51450  LRR  
PS50177  NTF2_DOMAIN  
PS51281  TAP_C  
CDD cd14342  UBA_TAP-C  
Amino Acid Sequences MLRRKRERRNAVKENEMVIDTPLEKRRTPGKPRATREPPISVVITGHSKGSEDDLISFVWRKVKVRLMNISYSPASVTAVVKSQDFSRLNGLNGAAFAGDHLAIRRVDGASNVTQDYRKAKTKRSFRSVSAPSLSALATQAQRNVSKTLPQSTNETIEKLRQFLQTRYQPATKFLDLGNLQQDPLLKQMGILAEASTKSKMFPALMKVASLNFPDVISVSLSDNNLQSVTAVTTLAQTWPKLLNLSLANNRITSLSDLDPWSPKTKLPELQELVLVGNPIVTTFANRAMDYQREMVSRFPKLRLLDGNSINSEIIASQSTVPFPVYQSFFDKVETEQIVNSFLAAFFKGWDENRSALVNQLYSPNATFSISLNASNVRTNFSQKTDTKKWGAYKMKSRNLLYSQSQKESKSRLFNGHEEISNAVKSLPATAHDLSDRSQWVFDGWNLVLPSVGAAIKIVVHGQFEEPQNKRLLRSFDRTLLILPGGSTGILIINDLLVIRSFAGSLGWLPGQSSVRTSNNAMSASASKPSDIVQPRPEQAMLDTRQQIVLKIKAETGLNDYYAHMCCEQNNWDYNSALASFLELKSRNVIPAEAFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.65
3 0.55
4 0.45
5 0.35
6 0.3
7 0.23
8 0.25
9 0.29
10 0.3
11 0.29
12 0.34
13 0.42
14 0.49
15 0.58
16 0.62
17 0.66
18 0.72
19 0.79
20 0.85
21 0.84
22 0.82
23 0.79
24 0.75
25 0.67
26 0.61
27 0.55
28 0.45
29 0.37
30 0.32
31 0.3
32 0.24
33 0.21
34 0.17
35 0.17
36 0.16
37 0.2
38 0.19
39 0.15
40 0.16
41 0.16
42 0.16
43 0.18
44 0.19
45 0.18
46 0.21
47 0.23
48 0.25
49 0.29
50 0.38
51 0.43
52 0.49
53 0.56
54 0.55
55 0.58
56 0.57
57 0.56
58 0.48
59 0.41
60 0.34
61 0.24
62 0.2
63 0.16
64 0.16
65 0.12
66 0.15
67 0.16
68 0.16
69 0.16
70 0.17
71 0.24
72 0.24
73 0.24
74 0.28
75 0.29
76 0.3
77 0.31
78 0.3
79 0.21
80 0.2
81 0.18
82 0.11
83 0.08
84 0.07
85 0.06
86 0.06
87 0.06
88 0.07
89 0.1
90 0.1
91 0.1
92 0.12
93 0.12
94 0.12
95 0.13
96 0.17
97 0.16
98 0.19
99 0.19
100 0.19
101 0.19
102 0.22
103 0.25
104 0.27
105 0.34
106 0.36
107 0.45
108 0.53
109 0.62
110 0.69
111 0.74
112 0.74
113 0.69
114 0.74
115 0.69
116 0.66
117 0.59
118 0.49
119 0.4
120 0.36
121 0.32
122 0.22
123 0.18
124 0.15
125 0.14
126 0.14
127 0.17
128 0.2
129 0.22
130 0.24
131 0.25
132 0.23
133 0.26
134 0.29
135 0.34
136 0.34
137 0.33
138 0.37
139 0.37
140 0.42
141 0.37
142 0.36
143 0.29
144 0.32
145 0.32
146 0.28
147 0.28
148 0.29
149 0.31
150 0.32
151 0.4
152 0.41
153 0.45
154 0.48
155 0.49
156 0.43
157 0.44
158 0.47
159 0.38
160 0.33
161 0.28
162 0.3
163 0.26
164 0.28
165 0.27
166 0.21
167 0.2
168 0.2
169 0.21
170 0.14
171 0.16
172 0.14
173 0.1
174 0.09
175 0.12
176 0.11
177 0.1
178 0.1
179 0.08
180 0.09
181 0.09
182 0.11
183 0.1
184 0.09
185 0.09
186 0.1
187 0.11
188 0.11
189 0.13
190 0.17
191 0.21
192 0.22
193 0.22
194 0.21
195 0.21
196 0.21
197 0.19
198 0.15
199 0.1
200 0.09
201 0.09
202 0.09
203 0.08
204 0.07
205 0.07
206 0.07
207 0.09
208 0.09
209 0.1
210 0.1
211 0.1
212 0.09
213 0.08
214 0.07
215 0.06
216 0.06
217 0.06
218 0.05
219 0.05
220 0.06
221 0.06
222 0.08
223 0.09
224 0.08
225 0.1
226 0.11
227 0.11
228 0.11
229 0.11
230 0.13
231 0.14
232 0.18
233 0.2
234 0.22
235 0.22
236 0.22
237 0.22
238 0.18
239 0.17
240 0.14
241 0.13
242 0.11
243 0.12
244 0.13
245 0.14
246 0.15
247 0.16
248 0.18
249 0.16
250 0.17
251 0.2
252 0.23
253 0.28
254 0.29
255 0.36
256 0.34
257 0.34
258 0.33
259 0.29
260 0.24
261 0.19
262 0.15
263 0.07
264 0.05
265 0.04
266 0.04
267 0.05
268 0.04
269 0.05
270 0.06
271 0.09
272 0.1
273 0.1
274 0.12
275 0.13
276 0.14
277 0.15
278 0.16
279 0.14
280 0.14
281 0.15
282 0.17
283 0.18
284 0.21
285 0.21
286 0.21
287 0.23
288 0.23
289 0.25
290 0.25
291 0.27
292 0.3
293 0.3
294 0.31
295 0.27
296 0.26
297 0.23
298 0.19
299 0.14
300 0.08
301 0.06
302 0.05
303 0.05
304 0.05
305 0.06
306 0.06
307 0.07
308 0.07
309 0.07
310 0.07
311 0.1
312 0.11
313 0.12
314 0.16
315 0.17
316 0.17
317 0.18
318 0.18
319 0.15
320 0.18
321 0.17
322 0.14
323 0.12
324 0.12
325 0.13
326 0.12
327 0.11
328 0.07
329 0.06
330 0.06
331 0.06
332 0.06
333 0.05
334 0.06
335 0.08
336 0.09
337 0.1
338 0.12
339 0.13
340 0.14
341 0.15
342 0.14
343 0.15
344 0.15
345 0.14
346 0.12
347 0.13
348 0.12
349 0.11
350 0.12
351 0.1
352 0.1
353 0.1
354 0.09
355 0.08
356 0.12
357 0.12
358 0.12
359 0.12
360 0.13
361 0.14
362 0.16
363 0.15
364 0.14
365 0.15
366 0.19
367 0.21
368 0.22
369 0.29
370 0.3
371 0.38
372 0.41
373 0.46
374 0.45
375 0.47
376 0.49
377 0.52
378 0.57
379 0.55
380 0.59
381 0.64
382 0.67
383 0.69
384 0.66
385 0.62
386 0.58
387 0.56
388 0.51
389 0.51
390 0.48
391 0.46
392 0.48
393 0.44
394 0.44
395 0.45
396 0.46
397 0.44
398 0.44
399 0.46
400 0.48
401 0.49
402 0.5
403 0.47
404 0.41
405 0.34
406 0.32
407 0.26
408 0.22
409 0.18
410 0.13
411 0.1
412 0.1
413 0.11
414 0.09
415 0.09
416 0.14
417 0.14
418 0.16
419 0.16
420 0.17
421 0.16
422 0.2
423 0.19
424 0.16
425 0.15
426 0.14
427 0.14
428 0.15
429 0.14
430 0.15
431 0.13
432 0.16
433 0.15
434 0.15
435 0.14
436 0.12
437 0.12
438 0.09
439 0.09
440 0.05
441 0.05
442 0.05
443 0.05
444 0.06
445 0.07
446 0.06
447 0.07
448 0.08
449 0.1
450 0.14
451 0.18
452 0.26
453 0.27
454 0.3
455 0.36
456 0.36
457 0.37
458 0.38
459 0.42
460 0.4
461 0.46
462 0.47
463 0.46
464 0.47
465 0.45
466 0.41
467 0.35
468 0.28
469 0.21
470 0.16
471 0.11
472 0.1
473 0.09
474 0.07
475 0.05
476 0.06
477 0.06
478 0.06
479 0.05
480 0.05
481 0.05
482 0.05
483 0.05
484 0.04
485 0.05
486 0.05
487 0.05
488 0.05
489 0.05
490 0.06
491 0.06
492 0.06
493 0.08
494 0.08
495 0.08
496 0.09
497 0.13
498 0.15
499 0.15
500 0.17
501 0.21
502 0.23
503 0.26
504 0.28
505 0.28
506 0.3
507 0.3
508 0.27
509 0.24
510 0.25
511 0.23
512 0.26
513 0.22
514 0.18
515 0.18
516 0.19
517 0.25
518 0.28
519 0.32
520 0.35
521 0.41
522 0.43
523 0.45
524 0.44
525 0.36
526 0.34
527 0.37
528 0.33
529 0.34
530 0.35
531 0.33
532 0.36
533 0.36
534 0.36
535 0.34
536 0.37
537 0.32
538 0.3
539 0.3
540 0.3
541 0.31
542 0.28
543 0.27
544 0.24
545 0.22
546 0.22
547 0.22
548 0.22
549 0.22
550 0.23
551 0.19
552 0.18
553 0.18
554 0.22
555 0.26
556 0.28
557 0.33
558 0.34
559 0.35
560 0.34
561 0.33
562 0.31
563 0.26
564 0.21
565 0.15
566 0.14
567 0.14
568 0.14
569 0.21
570 0.2
571 0.21
572 0.26
573 0.27
574 0.28
575 0.27
576 0.28