Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9UUA0

Protein Details
Accession Q9UUA0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
53-79SESNGISKKKKNKKQTSKKAKDKLAAAHydrophilic
NLS Segment(s)
PositionSequence
59-106SKKKKNKKQTSKKAKDKLAAALKAQAREERLDTKISKSLQKQEKLKAR
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0000055  P:ribosomal large subunit export from nucleus  
KEGG spo:SPCC23B6.02c  -  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAKKQSIRSRNFRRSDPAYDLDSSTAIENETKLSVKEKVAKEIANIALRSGGSESNGISKKKKNKKQTSKKAKDKLAAALKAQAREERLDTKISKSLQKQEKLKARKQGDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.69
3 0.65
4 0.58
5 0.51
6 0.47
7 0.43
8 0.35
9 0.29
10 0.23
11 0.17
12 0.13
13 0.1
14 0.09
15 0.08
16 0.09
17 0.1
18 0.09
19 0.09
20 0.12
21 0.14
22 0.17
23 0.25
24 0.25
25 0.29
26 0.31
27 0.31
28 0.29
29 0.31
30 0.31
31 0.27
32 0.25
33 0.2
34 0.18
35 0.17
36 0.17
37 0.13
38 0.1
39 0.07
40 0.07
41 0.07
42 0.12
43 0.16
44 0.17
45 0.19
46 0.25
47 0.34
48 0.44
49 0.53
50 0.59
51 0.67
52 0.77
53 0.85
54 0.91
55 0.92
56 0.93
57 0.95
58 0.92
59 0.87
60 0.81
61 0.73
62 0.7
63 0.67
64 0.58
65 0.49
66 0.46
67 0.42
68 0.39
69 0.38
70 0.32
71 0.25
72 0.25
73 0.28
74 0.25
75 0.25
76 0.28
77 0.28
78 0.3
79 0.33
80 0.34
81 0.38
82 0.4
83 0.48
84 0.52
85 0.6
86 0.63
87 0.67
88 0.74
89 0.76
90 0.77
91 0.77