Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2EC86

Protein Details
Accession A0A0G2EC86    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
82-121AKTPTKAKTPRTPRKKAAEKKSGKESPTKKRKVKEESADEBasic
NLS Segment(s)
PositionSequence
82-115AKTPTKAKTPRTPRKKAAEKKSGKESPTKKRKVK
Subcellular Location(s) nucl 15.5, mito_nucl 9, cyto 8
Family & Domain DBs
Amino Acid Sequences MAPKANPEKAEADQATLLLSVIKNTEGVTNWNTVAQECGISTGSAVQKRIKRLRDKYPSETDGGAPTSTNGDDAQDAKPEAAKTPTKAKTPRTPRKKAAEKKSGKESPTKKRKVKEESADEAETKEEDGSDEQGSDEAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.2
4 0.17
5 0.1
6 0.1
7 0.08
8 0.08
9 0.08
10 0.08
11 0.09
12 0.11
13 0.1
14 0.13
15 0.15
16 0.16
17 0.16
18 0.17
19 0.17
20 0.15
21 0.15
22 0.12
23 0.1
24 0.08
25 0.1
26 0.09
27 0.08
28 0.08
29 0.11
30 0.15
31 0.16
32 0.18
33 0.22
34 0.25
35 0.34
36 0.42
37 0.45
38 0.51
39 0.56
40 0.65
41 0.7
42 0.73
43 0.72
44 0.71
45 0.66
46 0.57
47 0.51
48 0.41
49 0.32
50 0.26
51 0.19
52 0.12
53 0.1
54 0.09
55 0.08
56 0.08
57 0.06
58 0.06
59 0.06
60 0.08
61 0.08
62 0.09
63 0.09
64 0.08
65 0.1
66 0.1
67 0.11
68 0.14
69 0.15
70 0.16
71 0.25
72 0.3
73 0.35
74 0.4
75 0.45
76 0.51
77 0.6
78 0.68
79 0.69
80 0.74
81 0.76
82 0.81
83 0.85
84 0.85
85 0.84
86 0.85
87 0.83
88 0.8
89 0.82
90 0.77
91 0.69
92 0.69
93 0.67
94 0.67
95 0.7
96 0.74
97 0.71
98 0.74
99 0.81
100 0.81
101 0.82
102 0.81
103 0.79
104 0.77
105 0.76
106 0.7
107 0.61
108 0.52
109 0.42
110 0.32
111 0.24
112 0.17
113 0.1
114 0.1
115 0.11
116 0.13
117 0.13
118 0.13
119 0.12