Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2GY90

Protein Details
Accession A0A0G2GY90    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-82LDRVSIAKRKPKKEPNKKKREVLTVRBasic
NLS Segment(s)
PositionSequence
62-76IAKRKPKKEPNKKKR
Subcellular Location(s) nucl 18.5, mito_nucl 10.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR002717  HAT_MYST-type  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0004402  F:histone acetyltransferase activity  
GO:0016573  P:histone acetylation  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF01853  MOZ_SAS  
PROSITE View protein in PROSITE  
PS51726  MYST_HAT  
Amino Acid Sequences MSVSYKLSGWEWEGGVIGGPEKPLSAMGKKSYSRFWEERVARYLLGESRDADGRRILDRVSIAKRKPKKEPNKKKREVLTVREIGERTGMLAEDVVVALVGMGVCEQVGRKSSTKKALETTNGENKSQPAASENEKEIPINLNIKKSKVLDWAKKNGLEFENPVAEEGFLGEWALSDENSDVDMDEEEDEDEESSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.12
4 0.1
5 0.08
6 0.08
7 0.07
8 0.07
9 0.07
10 0.09
11 0.13
12 0.16
13 0.2
14 0.24
15 0.32
16 0.35
17 0.37
18 0.41
19 0.42
20 0.46
21 0.45
22 0.44
23 0.47
24 0.48
25 0.51
26 0.49
27 0.46
28 0.37
29 0.35
30 0.33
31 0.26
32 0.24
33 0.2
34 0.17
35 0.17
36 0.22
37 0.22
38 0.2
39 0.2
40 0.19
41 0.2
42 0.19
43 0.17
44 0.15
45 0.16
46 0.21
47 0.26
48 0.31
49 0.33
50 0.42
51 0.5
52 0.53
53 0.62
54 0.67
55 0.7
56 0.75
57 0.83
58 0.85
59 0.89
60 0.91
61 0.88
62 0.84
63 0.84
64 0.8
65 0.74
66 0.72
67 0.65
68 0.59
69 0.53
70 0.46
71 0.36
72 0.29
73 0.22
74 0.13
75 0.09
76 0.07
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.03
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.03
94 0.03
95 0.06
96 0.09
97 0.11
98 0.16
99 0.21
100 0.3
101 0.33
102 0.34
103 0.36
104 0.37
105 0.4
106 0.4
107 0.41
108 0.41
109 0.4
110 0.38
111 0.35
112 0.32
113 0.3
114 0.26
115 0.19
116 0.13
117 0.14
118 0.18
119 0.21
120 0.22
121 0.22
122 0.22
123 0.22
124 0.2
125 0.2
126 0.19
127 0.22
128 0.23
129 0.28
130 0.29
131 0.3
132 0.34
133 0.33
134 0.33
135 0.36
136 0.43
137 0.45
138 0.51
139 0.58
140 0.59
141 0.6
142 0.58
143 0.53
144 0.46
145 0.4
146 0.35
147 0.3
148 0.28
149 0.26
150 0.26
151 0.21
152 0.18
153 0.15
154 0.13
155 0.09
156 0.06
157 0.06
158 0.05
159 0.05
160 0.06
161 0.07
162 0.06
163 0.07
164 0.07
165 0.07
166 0.08
167 0.08
168 0.07
169 0.07
170 0.08
171 0.08
172 0.08
173 0.09
174 0.08
175 0.09
176 0.09