Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O74460

Protein Details
Accession O74460    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
145-167DPREEKAQKSKSKSRNQDERGSPHydrophilic
180-206TLMERIFQVRRKPRKSRRDRRSRVSKRBasic
NLS Segment(s)
PositionSequence
189-206RRKPRKSRRDRRSRVSKR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019416  NCBP3  
Gene Ontology GO:0005829  C:cytosol  
GO:0005846  C:nuclear cap binding complex  
GO:0005634  C:nucleus  
GO:0003729  F:mRNA binding  
GO:0000340  F:RNA 7-methylguanosine cap binding  
GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
KEGG spo:SPCC16C4.16c  -  
Pfam View protein in Pfam  
PF10309  NCBP3  
Amino Acid Sequences MDIVAETQIEEESLIPDATSTPLETEVVADTTLRKTALHLAGVDNLSEEQVKGFISAYAPESQCTIEWINDNECNVVYADDDVSRNALFHLIMESPTEFSEELEYQTKPHPTVPTCQFKIRYARYGDKKVKSAHLYSRYYLFHGDPREEKAQKSKSKSRNQDERGSPLDERLGPKVSDLTLMERIFQVRRKPRKSRRDRRSRVSKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.08
5 0.09
6 0.1
7 0.09
8 0.09
9 0.1
10 0.11
11 0.1
12 0.11
13 0.1
14 0.1
15 0.1
16 0.09
17 0.1
18 0.11
19 0.12
20 0.12
21 0.1
22 0.11
23 0.19
24 0.22
25 0.22
26 0.21
27 0.21
28 0.25
29 0.25
30 0.23
31 0.16
32 0.13
33 0.12
34 0.11
35 0.1
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.08
44 0.1
45 0.14
46 0.15
47 0.14
48 0.15
49 0.15
50 0.14
51 0.16
52 0.15
53 0.11
54 0.13
55 0.15
56 0.17
57 0.18
58 0.18
59 0.16
60 0.14
61 0.14
62 0.12
63 0.1
64 0.07
65 0.06
66 0.07
67 0.07
68 0.08
69 0.07
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.05
76 0.05
77 0.07
78 0.06
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07
84 0.08
85 0.07
86 0.06
87 0.09
88 0.08
89 0.1
90 0.11
91 0.11
92 0.11
93 0.14
94 0.15
95 0.14
96 0.16
97 0.19
98 0.18
99 0.26
100 0.32
101 0.38
102 0.39
103 0.43
104 0.42
105 0.42
106 0.49
107 0.45
108 0.44
109 0.41
110 0.47
111 0.5
112 0.57
113 0.61
114 0.57
115 0.58
116 0.55
117 0.56
118 0.51
119 0.49
120 0.48
121 0.48
122 0.47
123 0.43
124 0.45
125 0.39
126 0.36
127 0.34
128 0.27
129 0.23
130 0.23
131 0.26
132 0.23
133 0.27
134 0.34
135 0.34
136 0.35
137 0.39
138 0.45
139 0.49
140 0.56
141 0.61
142 0.63
143 0.72
144 0.8
145 0.81
146 0.83
147 0.81
148 0.82
149 0.77
150 0.73
151 0.67
152 0.6
153 0.51
154 0.41
155 0.4
156 0.33
157 0.31
158 0.29
159 0.28
160 0.24
161 0.25
162 0.25
163 0.21
164 0.21
165 0.2
166 0.21
167 0.24
168 0.24
169 0.24
170 0.24
171 0.26
172 0.27
173 0.31
174 0.36
175 0.4
176 0.51
177 0.6
178 0.7
179 0.78
180 0.85
181 0.91
182 0.93
183 0.93
184 0.94
185 0.95
186 0.94