Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9Y884

Protein Details
Accession Q9Y884   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
320-341LCVCLDKDKTRRPGPQKMLTHPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.833, cyto 10.5, nucl 9, cyto_pero 7.166, cysk 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005829  C:cytosol  
GO:0000935  C:division septum  
GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0004708  F:MAP kinase kinase activity  
GO:0106310  F:protein serine kinase activity  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0004713  F:protein tyrosine kinase activity  
GO:0000196  P:cell wall integrity MAPK cascade  
GO:0050850  P:positive regulation of calcium-mediated signaling  
GO:1903340  P:positive regulation of cell wall organization or biogenesis  
GO:0006468  P:protein phosphorylation  
GO:0060237  P:regulation of fungal-type cell wall organization  
KEGG spo:SPBC543.07  -  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd06621  PKc_Pek1_like  
Amino Acid Sequences MSKKPVLNLDTSNGFSEEYISHPERNDNQGIVEITDLVFSSESKLTQRKESRDSKTFVPSFLEELDDDHLHELVTNGGILYMNSLGEGVSGSVRKCRIRGTQMIFAMKTVLAAPNTALQKQLLRELKINRSCTSPYIVKYYGACYNNAECQLNIAMEYCGAGSLDAIYKRVRSQGGRTGERPLGKIAFGVLSGLSYLHDRKIIHRDIKPSNILLTSKGQVKLCDFGVSGELVNSLAGTFTGTSYYMAPERISGGSYTISSDIWSLGLTLMEVALNRFPFPPEGSPPPMPIELLSYIINMPPPLLPQEPGIKWSKSFQHFLCVCLDKDKTRRPGPQKMLTHPWVKAFERIHVDMEEFLRQVWSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.22
3 0.21
4 0.17
5 0.15
6 0.21
7 0.22
8 0.24
9 0.25
10 0.32
11 0.34
12 0.4
13 0.41
14 0.34
15 0.32
16 0.33
17 0.33
18 0.26
19 0.22
20 0.16
21 0.12
22 0.12
23 0.11
24 0.08
25 0.07
26 0.07
27 0.1
28 0.11
29 0.13
30 0.18
31 0.24
32 0.26
33 0.36
34 0.44
35 0.48
36 0.56
37 0.64
38 0.68
39 0.69
40 0.7
41 0.64
42 0.66
43 0.6
44 0.53
45 0.48
46 0.4
47 0.34
48 0.31
49 0.28
50 0.18
51 0.18
52 0.2
53 0.16
54 0.15
55 0.14
56 0.13
57 0.11
58 0.11
59 0.1
60 0.07
61 0.07
62 0.06
63 0.05
64 0.05
65 0.06
66 0.05
67 0.06
68 0.06
69 0.05
70 0.05
71 0.06
72 0.05
73 0.05
74 0.05
75 0.04
76 0.06
77 0.08
78 0.08
79 0.12
80 0.17
81 0.19
82 0.2
83 0.25
84 0.31
85 0.37
86 0.45
87 0.48
88 0.51
89 0.54
90 0.56
91 0.5
92 0.42
93 0.36
94 0.27
95 0.21
96 0.14
97 0.12
98 0.09
99 0.09
100 0.1
101 0.14
102 0.15
103 0.15
104 0.15
105 0.13
106 0.16
107 0.17
108 0.24
109 0.23
110 0.24
111 0.29
112 0.34
113 0.43
114 0.47
115 0.49
116 0.42
117 0.41
118 0.4
119 0.37
120 0.36
121 0.31
122 0.26
123 0.28
124 0.28
125 0.26
126 0.26
127 0.27
128 0.28
129 0.26
130 0.25
131 0.21
132 0.22
133 0.23
134 0.24
135 0.22
136 0.15
137 0.15
138 0.15
139 0.13
140 0.11
141 0.09
142 0.07
143 0.06
144 0.06
145 0.05
146 0.04
147 0.04
148 0.04
149 0.03
150 0.03
151 0.06
152 0.06
153 0.07
154 0.08
155 0.09
156 0.1
157 0.13
158 0.15
159 0.15
160 0.19
161 0.26
162 0.33
163 0.35
164 0.35
165 0.37
166 0.37
167 0.36
168 0.33
169 0.26
170 0.2
171 0.16
172 0.15
173 0.11
174 0.09
175 0.07
176 0.07
177 0.05
178 0.04
179 0.04
180 0.04
181 0.04
182 0.05
183 0.06
184 0.06
185 0.09
186 0.1
187 0.13
188 0.21
189 0.27
190 0.32
191 0.34
192 0.41
193 0.42
194 0.46
195 0.44
196 0.38
197 0.33
198 0.28
199 0.26
200 0.21
201 0.2
202 0.17
203 0.2
204 0.23
205 0.22
206 0.21
207 0.22
208 0.22
209 0.2
210 0.19
211 0.15
212 0.12
213 0.12
214 0.11
215 0.1
216 0.08
217 0.07
218 0.06
219 0.05
220 0.05
221 0.04
222 0.03
223 0.03
224 0.04
225 0.04
226 0.04
227 0.05
228 0.05
229 0.06
230 0.07
231 0.08
232 0.09
233 0.1
234 0.1
235 0.09
236 0.11
237 0.11
238 0.11
239 0.1
240 0.1
241 0.1
242 0.1
243 0.11
244 0.09
245 0.09
246 0.09
247 0.09
248 0.08
249 0.07
250 0.07
251 0.06
252 0.05
253 0.05
254 0.05
255 0.04
256 0.04
257 0.05
258 0.05
259 0.05
260 0.08
261 0.08
262 0.09
263 0.1
264 0.11
265 0.13
266 0.16
267 0.18
268 0.22
269 0.28
270 0.33
271 0.34
272 0.35
273 0.36
274 0.34
275 0.3
276 0.25
277 0.22
278 0.17
279 0.17
280 0.16
281 0.13
282 0.13
283 0.13
284 0.14
285 0.1
286 0.1
287 0.09
288 0.1
289 0.13
290 0.14
291 0.15
292 0.17
293 0.25
294 0.24
295 0.28
296 0.32
297 0.29
298 0.29
299 0.34
300 0.4
301 0.37
302 0.43
303 0.4
304 0.45
305 0.44
306 0.45
307 0.46
308 0.41
309 0.37
310 0.37
311 0.4
312 0.37
313 0.45
314 0.52
315 0.54
316 0.59
317 0.69
318 0.71
319 0.78
320 0.8
321 0.82
322 0.8
323 0.79
324 0.8
325 0.76
326 0.73
327 0.65
328 0.62
329 0.58
330 0.53
331 0.52
332 0.45
333 0.46
334 0.47
335 0.47
336 0.43
337 0.38
338 0.37
339 0.33
340 0.33
341 0.29
342 0.22
343 0.2