Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2EK51

Protein Details
Accession A0A0G2EK51   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRASNGRNKKGRGHVKPIRCSNCSHydrophilic
91-124VCSVRSREGRRNRAPPPRIRYNKDGKKINPQQAAHydrophilic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
97-117REGRRNRAPPPRIRYNKDGKK
Subcellular Location(s) nucl 14.5, mito_nucl 11.5, mito 7.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRASNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFTDYAVPKMYLKLQYCVSCAIHGKIVRNDSDNVCSVRSREGRRNRAPPPRIRYNKDGKKINPQQAAKTAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.79
4 0.77
5 0.77
6 0.83
7 0.84
8 0.81
9 0.73
10 0.72
11 0.7
12 0.7
13 0.69
14 0.67
15 0.64
16 0.65
17 0.68
18 0.7
19 0.72
20 0.71
21 0.73
22 0.74
23 0.75
24 0.72
25 0.73
26 0.68
27 0.68
28 0.6
29 0.53
30 0.46
31 0.37
32 0.35
33 0.28
34 0.25
35 0.16
36 0.15
37 0.12
38 0.1
39 0.1
40 0.08
41 0.08
42 0.06
43 0.05
44 0.06
45 0.06
46 0.06
47 0.09
48 0.08
49 0.09
50 0.09
51 0.09
52 0.09
53 0.1
54 0.12
55 0.15
56 0.16
57 0.18
58 0.2
59 0.21
60 0.22
61 0.24
62 0.21
63 0.18
64 0.18
65 0.17
66 0.18
67 0.19
68 0.21
69 0.23
70 0.25
71 0.24
72 0.25
73 0.27
74 0.25
75 0.26
76 0.25
77 0.22
78 0.21
79 0.2
80 0.18
81 0.24
82 0.29
83 0.32
84 0.39
85 0.49
86 0.58
87 0.66
88 0.74
89 0.75
90 0.79
91 0.81
92 0.81
93 0.79
94 0.8
95 0.81
96 0.79
97 0.79
98 0.79
99 0.8
100 0.8
101 0.81
102 0.74
103 0.76
104 0.8
105 0.8
106 0.79
107 0.73
108 0.7
109 0.68