Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q10353

Protein Details
Accession Q10353    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-55SKVFRFCRSKCHKNFKMKRNPRKVAWTKAYHydrophilic
165-191AEPVKIPVLAKKRKNKKSRNSSSAMQMHydrophilic
NLS Segment(s)
PositionSequence
42-49MKRNPRKV
174-183AKKRKNKKSR
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0042273  P:ribosomal large subunit biogenesis  
KEGG spo:SPAC22E12.13c  -  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRVHTCYFCSGPVYPGHGIMFVRNDSKVFRFCRSKCHKNFKMKRNPRKVAWTKAYRKAHGKEMVYDTALAVTAARRNVPVRYDRNVIATTLNAMKRVSQVHAKRERLFYKKRLAGKRAQELQEAQKLIAQNVPQFTEPEGEVETAEVQEPQIVSDEEYTMEEEVAEPVKIPVLAKKRKNKKSRNSSSAMQMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.24
4 0.22
5 0.21
6 0.21
7 0.22
8 0.19
9 0.2
10 0.19
11 0.19
12 0.21
13 0.24
14 0.29
15 0.29
16 0.35
17 0.42
18 0.43
19 0.53
20 0.59
21 0.66
22 0.69
23 0.77
24 0.78
25 0.8
26 0.89
27 0.89
28 0.9
29 0.91
30 0.91
31 0.91
32 0.89
33 0.84
34 0.85
35 0.82
36 0.8
37 0.79
38 0.78
39 0.75
40 0.78
41 0.79
42 0.74
43 0.74
44 0.67
45 0.66
46 0.62
47 0.56
48 0.51
49 0.48
50 0.45
51 0.37
52 0.33
53 0.24
54 0.18
55 0.16
56 0.11
57 0.06
58 0.05
59 0.07
60 0.08
61 0.08
62 0.09
63 0.11
64 0.12
65 0.16
66 0.22
67 0.24
68 0.28
69 0.31
70 0.3
71 0.32
72 0.3
73 0.28
74 0.21
75 0.16
76 0.14
77 0.15
78 0.14
79 0.12
80 0.12
81 0.12
82 0.13
83 0.15
84 0.15
85 0.19
86 0.22
87 0.31
88 0.4
89 0.43
90 0.44
91 0.49
92 0.54
93 0.53
94 0.56
95 0.53
96 0.53
97 0.56
98 0.61
99 0.62
100 0.6
101 0.61
102 0.62
103 0.65
104 0.62
105 0.58
106 0.52
107 0.47
108 0.48
109 0.45
110 0.38
111 0.29
112 0.24
113 0.22
114 0.21
115 0.2
116 0.17
117 0.14
118 0.15
119 0.17
120 0.15
121 0.16
122 0.16
123 0.15
124 0.14
125 0.13
126 0.13
127 0.11
128 0.1
129 0.1
130 0.1
131 0.08
132 0.08
133 0.07
134 0.06
135 0.07
136 0.07
137 0.07
138 0.08
139 0.08
140 0.09
141 0.1
142 0.1
143 0.1
144 0.11
145 0.11
146 0.1
147 0.09
148 0.08
149 0.08
150 0.09
151 0.09
152 0.08
153 0.08
154 0.07
155 0.09
156 0.1
157 0.1
158 0.16
159 0.25
160 0.35
161 0.44
162 0.54
163 0.64
164 0.74
165 0.84
166 0.88
167 0.89
168 0.91
169 0.93
170 0.91
171 0.87
172 0.81