Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P40231

Protein Details
Accession P40231    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
69-93CIIKVLKPVKYKKIKREIKILQNLAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045216  CK2_alpha  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0051286  C:cell tip  
GO:0000785  C:chromatin  
GO:0005829  C:cytosol  
GO:0000935  C:division septum  
GO:0044732  C:mitotic spindle pole body  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0005956  C:protein kinase CK2 complex  
GO:0034456  C:UTP-C complex  
GO:0005524  F:ATP binding  
GO:0106310  F:protein serine kinase activity  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006974  P:DNA damage response  
GO:0061245  P:establishment or maintenance of bipolar cell polarity  
GO:0007163  P:establishment or maintenance of cell polarity  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0018107  P:peptidyl-threonine phosphorylation  
GO:2000247  P:positive regulation of establishment or maintenance of bipolar cell polarity regulating cell shape  
GO:0006356  P:regulation of transcription by RNA polymerase I  
GO:0006359  P:regulation of transcription by RNA polymerase III  
GO:0023052  P:signaling  
KEGG spo:SPAC23C11.11  -  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd14132  STKc_CK2_alpha  
Amino Acid Sequences MNQTEAAPVVSVSRVYAHVNEEMPREYWDYENMQEVFGYQDNYEIIRKVGRGKYSEVFEGLNVLNNSKCIIKVLKPVKYKKIKREIKILQNLAGGPNIISLLDIVRDPESKTPSLIFEFVDNIDFRTLYPTLSDYDIRYYSYELLKALDFCHSRGIMHRDVKPHNVMIDHKKRKLRLIDWGLAEFYHAGMEYNVRVASRYFKGPELLVDFREYDYSLDIWSFGVMFAALIFKKDTFFRGRDNYDQLVKIAKVLGTDELFAYVQKYQIVLDRQYDNILGQYPKRDWYSFVNRDNRSLANDEAIDLLNRLLRYDHQERLTCQEAMAHPYFQVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.16
4 0.18
5 0.21
6 0.23
7 0.25
8 0.26
9 0.26
10 0.25
11 0.25
12 0.25
13 0.23
14 0.22
15 0.24
16 0.25
17 0.24
18 0.29
19 0.27
20 0.24
21 0.22
22 0.21
23 0.2
24 0.18
25 0.18
26 0.12
27 0.13
28 0.13
29 0.16
30 0.17
31 0.14
32 0.14
33 0.15
34 0.17
35 0.23
36 0.28
37 0.31
38 0.33
39 0.37
40 0.41
41 0.42
42 0.42
43 0.35
44 0.3
45 0.25
46 0.26
47 0.2
48 0.21
49 0.18
50 0.17
51 0.16
52 0.16
53 0.17
54 0.14
55 0.14
56 0.12
57 0.15
58 0.18
59 0.27
60 0.35
61 0.42
62 0.5
63 0.57
64 0.64
65 0.72
66 0.76
67 0.77
68 0.8
69 0.81
70 0.77
71 0.81
72 0.8
73 0.79
74 0.8
75 0.72
76 0.64
77 0.56
78 0.52
79 0.42
80 0.33
81 0.23
82 0.13
83 0.11
84 0.08
85 0.06
86 0.05
87 0.05
88 0.04
89 0.05
90 0.05
91 0.06
92 0.07
93 0.08
94 0.1
95 0.14
96 0.17
97 0.17
98 0.18
99 0.18
100 0.19
101 0.2
102 0.19
103 0.15
104 0.12
105 0.13
106 0.12
107 0.13
108 0.11
109 0.1
110 0.1
111 0.09
112 0.08
113 0.11
114 0.11
115 0.09
116 0.1
117 0.1
118 0.11
119 0.13
120 0.14
121 0.11
122 0.14
123 0.14
124 0.14
125 0.14
126 0.14
127 0.14
128 0.14
129 0.14
130 0.11
131 0.12
132 0.11
133 0.11
134 0.11
135 0.14
136 0.13
137 0.13
138 0.16
139 0.15
140 0.15
141 0.18
142 0.23
143 0.24
144 0.28
145 0.31
146 0.33
147 0.35
148 0.38
149 0.36
150 0.31
151 0.26
152 0.23
153 0.24
154 0.28
155 0.37
156 0.4
157 0.43
158 0.47
159 0.48
160 0.52
161 0.55
162 0.47
163 0.47
164 0.47
165 0.46
166 0.43
167 0.42
168 0.36
169 0.29
170 0.27
171 0.17
172 0.1
173 0.06
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.06
180 0.06
181 0.06
182 0.07
183 0.07
184 0.11
185 0.13
186 0.16
187 0.16
188 0.17
189 0.19
190 0.18
191 0.2
192 0.21
193 0.2
194 0.18
195 0.18
196 0.17
197 0.16
198 0.17
199 0.15
200 0.1
201 0.1
202 0.09
203 0.08
204 0.07
205 0.07
206 0.07
207 0.06
208 0.06
209 0.04
210 0.04
211 0.04
212 0.03
213 0.03
214 0.06
215 0.06
216 0.06
217 0.07
218 0.08
219 0.09
220 0.1
221 0.14
222 0.17
223 0.19
224 0.25
225 0.31
226 0.36
227 0.4
228 0.44
229 0.43
230 0.42
231 0.4
232 0.35
233 0.32
234 0.27
235 0.23
236 0.19
237 0.16
238 0.13
239 0.13
240 0.15
241 0.12
242 0.13
243 0.12
244 0.12
245 0.11
246 0.11
247 0.11
248 0.09
249 0.1
250 0.1
251 0.1
252 0.09
253 0.15
254 0.19
255 0.2
256 0.24
257 0.25
258 0.25
259 0.26
260 0.26
261 0.21
262 0.18
263 0.19
264 0.18
265 0.18
266 0.22
267 0.23
268 0.27
269 0.31
270 0.3
271 0.3
272 0.36
273 0.45
274 0.48
275 0.56
276 0.6
277 0.58
278 0.61
279 0.61
280 0.54
281 0.47
282 0.42
283 0.35
284 0.29
285 0.27
286 0.24
287 0.22
288 0.21
289 0.17
290 0.14
291 0.13
292 0.13
293 0.12
294 0.13
295 0.12
296 0.15
297 0.23
298 0.28
299 0.35
300 0.38
301 0.43
302 0.45
303 0.5
304 0.52
305 0.44
306 0.38
307 0.37
308 0.33
309 0.35
310 0.36
311 0.29
312 0.25