Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2GZY7

Protein Details
Accession A0A0G2GZY7   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
53-75SDKTLRLWPEKKRKPAHPAAEEHBasic
NLS Segment(s)
PositionSequence
63-67KKRKP
Subcellular Location(s) mito 8plas 8, nucl 4.5, cyto_nucl 4, cyto 2.5, extr 1, pero 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR010530  B12D  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF06522  B12D  
Amino Acid Sequences MMAPVPKEEHSAHTISQRLRTLKKMPPELIPLFVVVAFAVFAACFAMARKLTSDKTLRLWPEKKRKPAHPAAEEHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.36
4 0.37
5 0.39
6 0.39
7 0.44
8 0.45
9 0.46
10 0.52
11 0.53
12 0.49
13 0.47
14 0.51
15 0.46
16 0.41
17 0.36
18 0.27
19 0.2
20 0.18
21 0.14
22 0.07
23 0.06
24 0.04
25 0.03
26 0.03
27 0.02
28 0.02
29 0.02
30 0.02
31 0.03
32 0.03
33 0.06
34 0.07
35 0.08
36 0.1
37 0.13
38 0.15
39 0.21
40 0.24
41 0.24
42 0.28
43 0.33
44 0.37
45 0.42
46 0.48
47 0.52
48 0.6
49 0.67
50 0.73
51 0.76
52 0.8
53 0.8
54 0.84
55 0.84
56 0.81