Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2EBX2

Protein Details
Accession A0A0G2EBX2   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
101-126DASRVTEKQKKKQVHFPQRKYAVKAEHydrophilic
NLS Segment(s)
PositionSequence
86-112RAKKTRAIRRQLTKADASRVTEKQKKK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSAKVKTGSLWSKSKDDLKKQLDDAKTELGQLRVQKVAGGASSKLTRIHDLRKSIARILTVINANQRSALRAYYAKKKYTPLDLRAKKTRAIRRQLTKADASRVTEKQKKKQVHFPQRKYAVKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.57
3 0.56
4 0.57
5 0.61
6 0.61
7 0.62
8 0.62
9 0.65
10 0.59
11 0.53
12 0.47
13 0.42
14 0.36
15 0.33
16 0.3
17 0.24
18 0.24
19 0.24
20 0.23
21 0.2
22 0.19
23 0.18
24 0.16
25 0.15
26 0.13
27 0.12
28 0.1
29 0.11
30 0.12
31 0.13
32 0.14
33 0.15
34 0.18
35 0.19
36 0.26
37 0.29
38 0.31
39 0.34
40 0.37
41 0.37
42 0.36
43 0.34
44 0.27
45 0.23
46 0.2
47 0.19
48 0.15
49 0.14
50 0.16
51 0.15
52 0.15
53 0.15
54 0.15
55 0.13
56 0.13
57 0.12
58 0.11
59 0.15
60 0.18
61 0.27
62 0.31
63 0.33
64 0.34
65 0.38
66 0.39
67 0.45
68 0.48
69 0.46
70 0.53
71 0.57
72 0.62
73 0.66
74 0.66
75 0.6
76 0.63
77 0.65
78 0.63
79 0.66
80 0.68
81 0.69
82 0.76
83 0.76
84 0.72
85 0.7
86 0.64
87 0.61
88 0.55
89 0.5
90 0.47
91 0.47
92 0.51
93 0.52
94 0.56
95 0.6
96 0.66
97 0.71
98 0.71
99 0.77
100 0.79
101 0.82
102 0.86
103 0.84
104 0.86
105 0.87
106 0.87