Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O74850

Protein Details
Accession O74850   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
74-95FVTGKDRQKRWLRNAPPYRWFCHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, extr 8, E.R. 5, mito 1, cyto 1, golg 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007130  DAGAT  
Gene Ontology GO:0032541  C:cortical endoplasmic reticulum  
GO:0005737  C:cytoplasm  
GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0005811  C:lipid droplet  
GO:0097038  C:perinuclear endoplasmic reticulum  
GO:0003846  F:2-acylglycerol O-acyltransferase activity  
GO:0004144  F:diacylglycerol O-acyltransferase activity  
GO:0046339  P:diacylglycerol metabolic process  
GO:0006071  P:glycerol metabolic process  
GO:0140042  P:lipid droplet formation  
GO:0019915  P:lipid storage  
GO:0019432  P:triglyceride biosynthetic process  
Pfam View protein in Pfam  
PF03982  DAGAT  
CDD cd07987  LPLAT_MGAT-like  
Amino Acid Sequences MSEETSIPGIIASTPPISKDSRRNVSHWLQALAVFLHSVSLTLTASWYTVLWAFLPFWPFLIVYLIWLIYDDGFVTGKDRQKRWLRNAPPYRWFCHYFPIRLHKTTELDSEKNYIFGYHPHGIISLGAFGGFASEGADFSKLFPGINVSVLTLNSNFYVPVYRDYLMALNINSVSKKSCVSILSRKPGDSVLIVIGGAQESLLSRPGQNNLVLKKRFGFVKLAFLTGSSLVPCFAFGESDIFEQVDNNPRTRIYKFQEIVKKIAGFTVPFFYGRGLLNKTFGLMPWRKPINIVVGEPIDVPKKSHPTNQEIYEVHEEYIRRLEGLWNKYKDVFLPNRISELKLSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.17
4 0.21
5 0.27
6 0.36
7 0.44
8 0.51
9 0.54
10 0.56
11 0.61
12 0.64
13 0.65
14 0.59
15 0.5
16 0.41
17 0.38
18 0.36
19 0.28
20 0.22
21 0.14
22 0.1
23 0.09
24 0.08
25 0.07
26 0.06
27 0.07
28 0.07
29 0.07
30 0.08
31 0.07
32 0.08
33 0.08
34 0.07
35 0.07
36 0.08
37 0.09
38 0.09
39 0.1
40 0.11
41 0.12
42 0.15
43 0.13
44 0.13
45 0.14
46 0.13
47 0.12
48 0.14
49 0.11
50 0.1
51 0.11
52 0.1
53 0.09
54 0.09
55 0.09
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.13
64 0.19
65 0.26
66 0.28
67 0.36
68 0.46
69 0.55
70 0.63
71 0.68
72 0.7
73 0.74
74 0.83
75 0.81
76 0.81
77 0.76
78 0.7
79 0.65
80 0.62
81 0.52
82 0.51
83 0.49
84 0.44
85 0.46
86 0.52
87 0.52
88 0.49
89 0.51
90 0.45
91 0.43
92 0.41
93 0.42
94 0.37
95 0.33
96 0.32
97 0.34
98 0.29
99 0.27
100 0.25
101 0.18
102 0.13
103 0.14
104 0.19
105 0.18
106 0.18
107 0.17
108 0.17
109 0.17
110 0.16
111 0.14
112 0.08
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.03
120 0.03
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.06
127 0.08
128 0.08
129 0.08
130 0.08
131 0.1
132 0.1
133 0.11
134 0.1
135 0.09
136 0.09
137 0.1
138 0.1
139 0.08
140 0.08
141 0.07
142 0.07
143 0.06
144 0.06
145 0.08
146 0.08
147 0.1
148 0.11
149 0.11
150 0.11
151 0.12
152 0.13
153 0.12
154 0.12
155 0.09
156 0.08
157 0.08
158 0.08
159 0.07
160 0.07
161 0.07
162 0.07
163 0.08
164 0.08
165 0.1
166 0.11
167 0.16
168 0.25
169 0.3
170 0.37
171 0.38
172 0.37
173 0.36
174 0.35
175 0.31
176 0.22
177 0.16
178 0.09
179 0.08
180 0.07
181 0.06
182 0.06
183 0.05
184 0.04
185 0.03
186 0.03
187 0.03
188 0.03
189 0.05
190 0.06
191 0.06
192 0.08
193 0.11
194 0.13
195 0.15
196 0.19
197 0.22
198 0.31
199 0.31
200 0.3
201 0.29
202 0.3
203 0.29
204 0.26
205 0.28
206 0.2
207 0.29
208 0.29
209 0.28
210 0.26
211 0.24
212 0.23
213 0.18
214 0.17
215 0.08
216 0.07
217 0.07
218 0.07
219 0.07
220 0.07
221 0.06
222 0.06
223 0.06
224 0.08
225 0.09
226 0.09
227 0.1
228 0.09
229 0.09
230 0.09
231 0.11
232 0.18
233 0.19
234 0.2
235 0.21
236 0.22
237 0.25
238 0.27
239 0.33
240 0.3
241 0.38
242 0.39
243 0.47
244 0.54
245 0.54
246 0.55
247 0.51
248 0.46
249 0.36
250 0.36
251 0.29
252 0.21
253 0.2
254 0.2
255 0.16
256 0.16
257 0.16
258 0.14
259 0.15
260 0.16
261 0.19
262 0.2
263 0.2
264 0.22
265 0.21
266 0.22
267 0.2
268 0.19
269 0.24
270 0.24
271 0.27
272 0.34
273 0.37
274 0.36
275 0.37
276 0.39
277 0.39
278 0.38
279 0.35
280 0.3
281 0.28
282 0.28
283 0.27
284 0.26
285 0.22
286 0.19
287 0.2
288 0.22
289 0.29
290 0.32
291 0.39
292 0.44
293 0.48
294 0.55
295 0.56
296 0.57
297 0.49
298 0.52
299 0.51
300 0.46
301 0.38
302 0.34
303 0.31
304 0.26
305 0.31
306 0.25
307 0.18
308 0.18
309 0.25
310 0.3
311 0.38
312 0.46
313 0.43
314 0.46
315 0.48
316 0.48
317 0.44
318 0.46
319 0.45
320 0.44
321 0.49
322 0.47
323 0.52
324 0.52
325 0.51